KEGG   Streptomyces ambofaciens: SAM23877_5617
Entry
SAM23877_5617     CDS       T04055                                 

Gene name
srm20
Definition
(GenBank) putative NDP-hexose aminotransferase
  KO
K13329  dTDP-4-dehydro-2,3,6-trideoxy-D-glucose 4-aminotransferase [EC:2.6.1.110]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00523  Polyketide sugar unit biosynthesis
samb01100  Metabolic pathways
samb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SAM23877_5617 (srm20)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:samb01007]
    SAM23877_5617 (srm20)
Enzymes [BR:samb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.110  dTDP-4-dehydro-2,3,6-trideoxy-D-glucose 4-aminotransferase
     SAM23877_5617 (srm20)
Amino acid related enzymes [BR:samb01007]
 Aminotransferase (transaminase)
  Others
   SAM23877_5617 (srm20)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AKZ58662
UniProt: A0A0K2B0P6
Position
complement(6000512..6001660)
AA seq 382 aa
MINLFQPQMGAEELAAVSEVFDDQWLGHGPRTAAFESAFAEHLGVGPEHVVFLNSGTAGL
FLALESLGLRPGDEVVLPSPSFLAAANAVQLSGARPVFCDTDPRTLNPALEHIEAAVTPR
TRAVIALHYGGHPGDIVRIAERCRERGITLIEDAACSVASRVDGRPVGTFGDLAMWSFDA
MKVLVTGDGGMIYVKDPGAAARIRRLAYHGLTRSSGLGYARVSARWWEMDVPEPGRRVIG
NDLTAAIGAVQLRRLPGFVARRREIVALYDSELSSLEGVLTPPAPPAGHESTHYFYWIQL
APGVRDRVARDLLTDGIYTTFRYAPLHKVPAYGHTGGELPGVERASERTLCLPLHPGLSD
ADVRTVVSSLRRALSAADPAPA
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgatcaatctcttccagccccagatgggggccgaggaactggcggcggtgtccgaggtc
ttcgacgaccaatggctcggtcacggaccccggaccgcggcgttcgagtccgcgttcgcc
gagcacctcggggtcggccccgagcacgtcgtcttcctcaactcgggcaccgccggcctc
ttcctggccctggagtcgctcggcctgcggcccggcgacgaggtcgtgctcccctcgccc
agcttcctcgccgcggcgaacgccgtacagctctcgggagcgcgcccggtgttctgcgac
accgacccgcggacgctgaaccccgccctggagcacatcgaggcggccgtcaccccgcgc
accagggccgtcatcgcgctccactacggcggccaccccggcgacatcgtgcgcatcgcc
gagcgctgccgggagcggggcatcaccctgatcgaggacgccgcgtgctccgtggcctcc
cgcgtcgacggccgaccggtcggcaccttcggcgacctcgccatgtggagcttcgacgcc
atgaaggtcctggtcaccggcgacggagggatgatctacgtcaaggaccccggggcggcc
gcccggatccggcgcctcgcctaccacggcctcacgcggtccagcggcctgggatacgcc
agggtctcggcgcgctggtgggagatggacgtccccgaaccgggccgccgcgtcatcggg
aacgacctcaccgcggccatcggcgcggtccagttgcgccggcttcccggcttcgtggcc
cgccgcagggagatcgtcgccctgtacgacagcgaactgagctcgctggagggcgtgctg
acaccgcccgcgccacccgcggggcacgagtccacgcactacttctactggatccagctg
gcccccggcgtccgggaccgggtggcacgcgacctgctcaccgacggcatctacaccacc
ttccgctacgcacctctgcacaaggtgcccgcctacggccacaccggaggcgaactgccc
ggcgtggagcgggcgtccgaacggaccctgtgcctgcccctgcaccccggcctgtcggac
gccgacgtccgcaccgtcgtgtcctccctgcgcagagccctgagcgccgcggatccggcc
cccgcctga

DBGET integrated database retrieval system