KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00500
Entry
SAOUHSC_00500     CDS       T00324                                 

Definition
(RefSeq) glutamine amidotransferase subunit PdxT
  KO
K08681  pyridoxal 5'-phosphate synthase pdxT subunit [EC:4.3.3.6]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00750  Vitamin B6 metabolism
sao01100  Metabolic pathways
sao01240  Biosynthesis of cofactors
Module
sao_M00916  Pyridoxal-P biosynthesis, R5P + glyceraldehyde-3P + glutamine => pyridoxal-P
Brite
KEGG Orthology (KO) [BR:sao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAOUHSC_00500
Enzymes [BR:sao01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.6  pyridoxal 5'-phosphate synthase (glutamine hydrolysing)
     SAOUHSC_00500
SSDB
Motif
Pfam: SNO GATase GATase_3 Peptidase_S51 DUF169
Other DBs
NCBI-GeneID: 3920412
NCBI-ProteinID: YP_499073
UniProt: Q2G0Q0
Position
501029..501589
AA seq 186 aa
MKIGVLALQGAVREHIRHIELSGHEGIAVKKVEQLEEIEGLILPGGESTTLRRLMNLYGF
KEALQNSTLPMFGTCAGLIVLAQDIVGEEGYLNKLNITVQRNSFGRQVDSFETELDIKGI
ATDIEGVFIRAPHIEKVGQGVDILCKVNEKIVAVQQGKYLGVSFHPELTDDYRVTDYFIN
HIVKKA
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaaaataggtgtattagcattacaaggtgcagtacgtgaacatattagacatattgaa
ttaagtggtcatgaaggtattgcagttaaaaaagttgaacaattagaagaaatcgagggc
ttaatattacctggtggcgagtctacaacgttacgtcgattaatgaatttatatggattt
aaagaggctttacaaaattcaactttacctatgtttggtacatgcgcaggattaatagtt
ctagcgcaagatatagttggtgaagaaggataccttaacaagttgaatattactgtacaa
cgaaactcattcggtagacaagttgacagctttgaaacagaattagatattaaaggtatc
gctacagatattgaaggtgtctttataagagccccacatattgaaaaagtaggtcaaggc
gtagatatcctatgtaaggttaatgagaaaattgtagctgttcagcaaggtaaatattta
ggcgtatcattccatcctgaattaacagatgactatagagtaactgattactttattaat
catattgtaaaaaaagcatag

DBGET integrated database retrieval system