KEGG   Scedosporium apiospermum: SAPIO_CDS10292
Entry
SAPIO_CDS10292    CDS       T06367                                 

Definition
(RefSeq) Nitrite reductase [NAD(P)H]
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
sapo  Scedosporium apiospermum
Pathway
sapo00910  Nitrogen metabolism
sapo01100  Metabolic pathways
Module
sapo_M00531  Assimilatory nitrate reduction, nitrate => ammonia
sapo_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:sapo00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SAPIO_CDS10292
Enzymes [BR:sapo01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     SAPIO_CDS10292
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Rieske NIR_SIR_ferr Fer2_BFD Rubredoxin_C 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 27719474
NCBI-ProteinID: XP_016638745
UniProt: A0A084FV34
Position
Unknown
AA seq 1084 aa
METTNGSVQNGHATRNGDEYTTTSHTNGEHRIESMNGRRKDEMNRSLENNANGYRRKRLV
VVGLGMVAMAFIEKLTKLDAKRREYDITVVGEESHLAYNRVGLSTFFDHRVIENLYLNPL
EWYSSFGDGWLSYHLNTRVTRIVPEAKYISTTNGDIIPYDILVLATGSDAVLPKYTPGHD
ATGVFVYRTIADLEALIDFSTRNKGSVGVAVGGGLLGLEAAKAMMDLDAFSSVKIIDRNE
YLLARQLDADAGHLVTEKVRELGLDVKHKKRIAAVDVDDCNHVTGVTFEDGEKLGCSCVC
FAIGVRPRDELADGAGILIGPRTGGFVVGEDLQTSVRDIYAIGDCSCWKDQTFGIIAPGV
EMADILSFNLTEGRFQEPRKFTRIDPSTKLKLLGIDVASFGDFFADRDGPSFPNGLRRTV
PGEELEDGGRGAPPVKALTYKDPFSAVYKKYLFTLDGKYLVGGMMIGDTNDYAKLAQMVR
NRTPLEVPPSQFILGAKTDTDPDGSDLPDDTQVCSCYNVTKGDIVQAVQSGDCKSLADIK
SCTKAVCQHFPYSRVDLYNIIAVKQIETFEAVMQEAGNNPGSLGCEVCKPTVASILASLF
NEHIMSKRQHHLQDTNDRFLANIQRNGTFSVVPRIPGGEITPAQLITIGKVAEKHNLYCK
ITGGQRIDLFGAKKKDLLGIWGELVDAGMESGHAYAKSLRTVKASELIRHLDIGLPANFV
GMAIRVEERYKSIRAPHKLKGGVSGCVRECAEAQSKDFGLIATEKGFNIFVGGNGGATPR
HAELLAKDVPPEDVISLLDRYIIFYIRTADRLQRTARWIENLPGGIDYLREVVVDDKLGI
GLHMEKQMQDLVGSYFCEWTEILNDPERQKAFRQFDNTDEEVETVEIITERDQERPTYWS
SQPAGEDFKTHQWSSLSWQPLIQANHFDNFPSAQVKRGDTQLAIFKVKGGYYASQQMCPH
KRAFILSDGLVGEDNGKYWVSCPYHKRNFELNGEEAGRCSNDDSMNIATFPVEGRDDGWV
YVKLPPVDELDALLGTSRWKTTKQESCAPFERLDQKLGNCGKGRRGRKPREVRKPALSTV
SLSW
NT seq 3255 nt   +upstreamnt  +downstreamnt
atggagactacgaacggctccgtgcaaaacggccacgccaccagaaacggtgacgagtat
accacaacctcccacacgaacggcgaacatagaattgagtccatgaatggccggaggaaa
gacgaaatgaatcggtcgttggaaaacaacgctaatgggtaccgaagaaaacgcctggtg
gtagtgggattgggcatggtagcgatggctttcatagagaaattgacaaagctcgatgcg
aagcggcgagaatacgatattactgtcgttggagaggagtctcacctagcgtataaccgc
gtgggtctgtcaacgtttttcgatcaccgcgtgatagaaaatctctatctcaaccctcta
gaatggtattcgtcctttggggatggttggctgagctaccacctcaacacccgagtgaca
aggatcgtccccgaggccaaatacatctctaccactaatggcgacataatcccctacgat
atcttggttctagcgaccggctcagatgcggtattgccaaagtataccccgggacacgac
gctacaggcgtattcgtatacagaacgattgcagacttagaagccttaatagatttctcg
acgcgaaacaaaggttcggtaggcgttgctgtcgggggtggcctactgggtctcgaggca
gccaaagccatgatggatctcgatgcgttctcgtccgtcaagattatcgatcgaaacgaa
tatctactggcgaggcaattggacgcagatgccggtcacctggtcacggaaaaggtacgg
gagctaggtctcgacgttaagcacaagaagcgaatcgcagctgttgatgttgacgactgt
aaccatgtcactggcgtcacatttgaggacggtgagaagctgggctgcagctgtgtttgc
tttgcgatcggtgtgagacctcgagacgagcttgcggacggtgctggcatccttatcggt
ccgaggaccggcggctttgtcgtcggcgaagacctgcaaacgtctgttcgcgatatttat
gcaattggtgattgttcgtgttggaaagaccagaccttcggcatcattgcccctggggtc
gagatggccgacattctctccttcaaccttacagaaggtcgcttccaagagccacgaaaa
ttcacccgcattgacccaagcacgaaactgaaactgctcgggatagacgtcgccagtttt
ggagacttcttcgccgaccgagatggtcccagctttcctaacggtctgaggcgaacagtc
ccaggggaagaactcgaggacggcggccgtggagcaccgccagtaaaggcgctaacatac
aaggatcccttcagtgccgtttacaaaaagtacctgtttacgctcgatggcaagtatcta
gttggcgggatgatgattggggacacgaacgattatgcaaaacttgcccaaatggtacga
aatcgtactccactcgaggtcccgcctagtcagttcatattaggtgccaagacggacaca
gatcctgacgggtccgatctccctgatgacacccaagtctgctcctgctataacgtcacc
aagggtgatatcgtccaagcggtacaatccggcgattgcaagagccttgccgacatcaag
tcttgcaccaaagcagtatgccagcattttccttactcgagagtggatttgtacaatatc
attgcggtgaagcagatcgaaaccttcgaggccgttatgcaagaggcagggaacaacccc
ggctctctcggctgtgaggtttgcaaaccaacagttgcgtcgattttggcgagcctattc
aatgaacacatcatgtcgaagcggcagcatcatctccaagatacgaacgaccggtttttg
gccaatatccaacggaacggcacgttttccgtcgtcccgcgtattcccggaggcgagatt
accccggcccagctgatcaccataggcaaggttgccgaaaagcacaacctctactgtaag
attacgggcgggcaacggatagatctctttggcgcgaagaagaaagatttgttgggaatc
tggggagaactggtcgatgccggaatggaaagtggtcacgcttatgcaaaatcattgaga
accgtcaaggcaagtgaattaattcgccacctcgatattgggcttcctgctaactttgtc
ggaatggccattcgtgtcgaagaacgatacaagagcatacgtgcacctcataagctgaag
ggcggtgtctcgggctgtgttcgagaatgcgccgaggcccaaagtaaagatttcggtctc
attgcaaccgagaaggggttcaacatattcgttggtggcaacggaggtgctacgccccga
catgccgagctattggcaaaagacgtgccgccggaagatgttatctctctcctagatcga
tacatcatattttacattcgtacggcagatcggctccagcggactgctcggtggatcgaa
aacctgccaggcggcattgactatcttcgcgaagtagtcgtcgatgacaagctcggcatc
gggttgcatatggagaaacaaatgcaagaccttgtcggcagttatttctgtgagtggact
gaaatcctcaatgacccagaacgacaaaaggcattccgacagtttgacaacacggacgag
gaggttgagactgtcgagatcataaccgagagggatcaagaacggcccacatactggtca
agccagccagccggcgaggacttcaagactcaccaatggtcaagcttatcttggcaacct
ctcattcaagcgaatcactttgacaacttcccctctgcacaggtgaagcgtggggacacc
caactggcgatattcaaggtcaagggtggctactacgcatcccagcaaatgtgtcctcac
aagcgagcctttattctttccgatggtctcgttggtgaggacaacgggaaatactgggtg
tcatgcccgtatcataagcgtaactttgagttgaatggtgaggaggctggacgttgctca
aacgatgactctatgaacattgcgaccttccccgtcgaggggagggacgatggatgggtc
tacgttaaactcccccctgttgatgaactggatgcactcctgggaacgtcgaggtggaag
acgaccaagcaagaaagctgcgccccatttgagagactggatcagaaactaggcaactgc
gggaaagggcggaggggcaggaagccccgggaagtacggaagccggcgttgtctactgta
tccctcagctggtga

DBGET integrated database retrieval system