KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0498
Entry
SAS0498           CDS       T00183                                 

Definition
(GenBank) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sas00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAS0498
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sas03011]
    SAS0498
Ribosome [BR:sas03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAS0498
  Bacteria
    SAS0498
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N Bac_DNA_binding DUF2267 CwsA PP2C_C
Other DBs
NCBI-ProteinID: CAG42273
GeneDB: SAS0498
UniProt: Q6GBU7
Position
567447..567815
AA seq 122 aa
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
LK
NT seq 369 nt   +upstreamnt  +downstreamnt
atggctaatcatgaacaaatcattgaagcgattaaagaaatgtcagtattagaattaaac
gacttagtaaaagcaattgaagaagaatttggtgtaactgcagctgctccagtagcagta
gcaggtgcagctggtggcgctgacgctgcagcagaaaaaactgaatttgacgttgagtta
acttcagctggttcatctaaaatcaaagttgttaaagctgttaaagaagcaactggttta
ggattaaaagatgctaaagaattagtagacggagctcctaaagtaatcaaagaagcttta
cctaaagaagaagctgaaaaacttaaagaacaattagaagaagttggagctactgtagaa
ttaaaataa

DBGET integrated database retrieval system