KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0982
Entry
SAS0982           CDS       T00183                                 

Name
(GenBank) hypothetical protein
  KO
K23597  staphostatin B
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Brite
KEGG Orthology (KO) [BR:sas00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sas01002]
    SAS0982
Peptidases and inhibitors [BR:sas01002]
 Peptidase inhibitors
  Family I57: staphostatin B family
   SAS0982
SSDB
Motif
Pfam: Staphostatin_B Staphostatin_A
Other DBs
NCBI-ProteinID: CAG42757
GeneDB: SAS0982
UniProt: Q6GAG6
Structure
PDB: 
1NYC 1QWX 1PXV 1Y4H

Position
complement(1050483..1050812)
AA seq 109 aa
MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
NT seq 330 nt   +upstreamnt  +downstreamnt
atgtatcaactacaatttataaatttagtttacgacacaaccaaactcacacatctagaa
caaaccaatatcaatttattcattggtaattggagtaatcatcaattacaaaaatcaatt
tgtatacgtcatggcgatgatacaagtcacaatcaatatcatattctttttatagatacg
gcacatcaacgcattaaattttcatctattgataatgaagaaatcatttatattcttgat
tatgatgatacacagcatatcctcatgcaaacgtcatccaaacaaggtattggcacttcg
cgcccaatcgtttatgagcgcttagtataa

DBGET integrated database retrieval system