KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1545Help
Entry
SA1545            CDS       T00051                                 

Gene name
serA
Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00260  Glycine, serine and threonine metabolism
sau00680  Methane metabolism
sau01100  Metabolic pathways
sau01120  Microbial metabolism in diverse environments
sau01130  Biosynthesis of antibiotics
sau01200  Carbon metabolism
sau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    SA1545 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SA1545 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sau04147]
    SA1545 (serA)
Enzymes [BR:sau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     SA1545 (serA)
    1.1.1.399  2-oxoglutarate reductase
     SA1545 (serA)
Exosome [BR:sau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SA1545 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 F420_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAB42813
NITE: SA1545
UniProt: A0A0H3JUJ5
Position
1765786..1767390
Genome map
AA seq 534 aa AA seqDB search
MKQFNVLVADPISKDGIKALLDHEQFNVDIQTGLSEEALIKIIPSYHALIVRSQTTVTEN
IINAADSLKVIARAGVGVDNININAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP
QAHQSLTNKEWNRNAFKGTELYHKTLGVIGAGRIGLGVAKRAQSFGMKILAFDPYLTDEK
AKSLSITKATVDEIAQHSDFVTLHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDE
KALIKALDEGQISRAAIDVFEHEPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNE
IIEILIDGTVTHAVNAPKMDLSNIDDTVKSFINLSQTVGELAIQLMYNAPSSIKITYGGD
LASIDSSLLTRTIITHILKDDLGPEVNIINALMLLNQQQVTLNIENNKAETGFSNYLEVE
LSNDSDSVKVGASVFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKY
NINIASMTLGRTEAGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQS
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttaatgtactcgttgcagatcccatatcaaaagatggtatcaaagcatta
ttagatcacgaacaattcaatgtagatattcaaactggcttgtccgaagaagcattaatc
aaaattataccttcataccatgctttaatcgttcgtagtcaaactacggttactgaaaat
atcataaatgctgctgattctttaaaagtaatcgcacgcgccggtgttggtgtagataat
attaatattaatgctgcaacattaaaaggtattttagttattaatgccccagatggtaat
acgatttcagctactgaacattcactggcaatgttattatcaatggctcgaaatattccg
caagcacaccaatcacttacaaataaagaatggaatcgaaatgcatttaaaggtactgag
ctttatcataaaacattaggtgtcattggtgctggtagaattggtttaggtgttgctaaa
cgtgcgcaaagtttcggaatgaaaatactagcttttgacccttacttaacggatgaaaaa
gcaaaatctttaagtattacgaaggcaacagttgatgagattgcccaacattctgatttc
gttacattacatacaccactaacacctaaaacaaaaggcttaattaatgctgactttttt
gccaaagcaaaacctagtttgcaaataatcaatgtggcacgtggtggtattattgatgaa
aaggcgctaataaaagcattagacgaaggacaaattagtcgggcagctatcgatgtgttt
gaacatgaacctgcaactgattcgcctcttgttgcacatgataaaattattgttacacct
catttgggtgcatcaacagtcgaagctcaagaaaaagtggcaatttctgtttcaaatgaa
atcatcgaaattttaattgatggtactgtaacgcatgcagtgaatgcacctaaaatggac
ttaagcaatatagatgatactgtaaaatcattcatcaatttaagccaaacagttggtgaa
ttagctattcaattaatgtacaatgcaccaagctctattaaaattacgtacggtggcgac
ttagcctctattgatagtagtttattaacacgtacaattattactcatattttaaaagat
gatcttggtcctgaagtcaatattatcaatgctctaatgttgttaaatcaacaacaagtg
acattaaatattgaaaataataaagcagagacaggttttagtaactacttagaggtagaa
ctatcaaacgatagcgattccgttaaagttggcgcttctgtctttacaggtttcggtcca
agaattgttagaattaataatttttctgtagacttaaagccaaatcaatatcaaattgtg
tcatatcataatgatactccaggtatggtaggaaaaactggcgcattgttaggtaaatac
aatatcaacattgcatctatgactttaggtagaactgaagcgggcggagatgcgctaatg
attttatccgttgatcaacctgtttcaaacaatataattgatgaacttaaacaagttggt
gaatacaatcaaattttcacaactgaattgacggtacagtcataa

DBGET integrated database retrieval system