KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA2149
Entry
SA2149            CDS       T00051                                 
Name
(GenBank) ORFID:SA2149; hypothetical protein, similar to ABC transporter, ATP-binding protein
  KO
K09814  hemin transport system ATP-binding protein [EC:7.6.2.-]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SA2149
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sau02000]
    SA2149
Transporters [BR:sau02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Hemin transporter
    SA2149
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_21 CbiA AAA_16 AAA_13 AAA_29 AAA_18 AAA_25 NACHT AAA_30 AAA_33 AAA_22 CPT T2SSE RsgA_GTPase cobW TsaE Zeta_toxin AAA_5 AAA_23 AAA_28
Other DBs
NCBI-ProteinID: BAB43451
NITE: SA2149
UniProt: Q7A3X3
Position
complement(2415058..2415723)
AA seq 221 aa
MALVVKDIVKNFGEGLSETKVLKGINFEVEQGEFVILNGASGSGKTTLLTILGGLLSQTS
GTVLYNDAPLFDKQHRPSDLRLEDIGFIFQSSHLVPYLKVIEQLTLVGQEAGMTKQQSST
RAIQLLKNIGLEDRLNVYPHQLSGGEKQRVAIMRAFMNNPKIILADEPTASLDADRATKV
VEMIRQQIKEQQMIGIMITHDRRLFEYADRVIELEDGKITD
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcattagtcgttaaagatatcgtcaaaaatttcggagaaggtttgtctgaaacaaaa
gttttaaaaggtattaattttgaagtggaacaaggggaatttgtcattttaaatggtgcc
tctggttctgggaaaacaacattgctaacgatattaggcggattgttaagtcaaacgagt
ggtacagtgctttacaatgatgcaccattgtttgataaacagcatcgtcctagtgatttg
cgattggaagatattggttttatttttcaatcttcacatttagttccttatttaaaagtg
atagagcaattgacactcgtaggccaagaagcgggaatgaccaaacaacaaagttcaaca
agagcaatacaacttttgaaaaatattgggttagaagatcgcttgaatgtatatccgcat
cagttatctggcggtgaaaagcaacgtgttgcgattatgagagcatttatgaataatccg
aaaatcattttagcagatgagcccacagcaagtttagatgccgatagagcaacaaaagtt
gttgagatgatacgtcaacaaattaaagaacaacaaatgattggtattatgattacacac
gatcgaagattatttgaatatgcagatcgagtgattgaattagaagatggcaaaataact
gattag

DBGET integrated database retrieval system