KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1019990Help
Entry
SAI5S5_1019990    CDS       T03148                                 

Gene name
hisF
Definition
(GenBank) Imidazole glycerol phosphate synthase subunit HisF
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Pathway
sauw00340  Histidine metabolism
sauw01100  Metabolic pathways
sauw01110  Biosynthesis of secondary metabolites
sauw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sauw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SAI5S5_1019990 (hisF)
Enzymes [BR:sauw01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     SAI5S5_1019990 (hisF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth Dus TMP-TENI NMO G3P_antiterm ThiG
Motif
Other DBs
NCBI-ProteinID: CCJ19772
Position
complement(2722661..2723236)
Genome map
AA seq 191 aa AA seqDB search
MLEVIEQTASRLFIPLTVGGGIQSLDDITQLLNHGADKVSLNSSALKNPQLIKQASDKFG
RQCICIAIDSYYDPERKAHYCCTHGGKKMTNIKVYDWVQQVEQLGAGELLVTSMGHDGMK
QGFDIEHLAKIKSLVNIPIIASGGGGNAQHFVELFNQTDVSAGLAASILHDRETTVQSIK
EVIRQGGIAVR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgctagaagtgattgaacagacagcgtcacgcttgtttatccctcttactgtagggggt
gggattcaaagtctcgatgatattacccaattgttaaatcatggtgcagataaagtatca
ttaaattcaagtgctttaaaaaatccacagctcattaaacaagcgagtgataaattcggt
agacaatgcatctgtatagcaattgatagctattatgatcctgaaagaaaagcacattat
tgttgtacgcatggtggtaaaaaaatgacaaatattaaagtatatgactgggtacagcaa
gtagaacagttaggtgcaggtgagctcctcgttacaagtatgggacatgatggtatgaaa
caaggatttgatattgagcatcttgcaaaaataaaatcccttgtaaatattccaatcatt
gcttctggtggtggtggcaatgcacaacactttgtagaactatttaatcagacggatgtt
tctgcaggtttagctgcaagtatattacatgaccgagaaacgacggttcaatcaattaaa
gaagtgatacggcaagggggtatagcagtaagatga

DBGET integrated database retrieval system