KEGG   Saccharomyces cerevisiae (budding yeast): YBR177CHelp
Entry
YBR177C           CDS       T00005                                 

Gene name
EHT1
Definition
(RefSeq) medium-chain fatty acid ethyl ester synthase/esterase
  KO
K07019  uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    YBR177C (EHT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 ORC3_N Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 852476
NCBI-ProteinID: NP_009736
SGD: S000000381
UniProt: P38295
Position
II:complement(584807..586162)
Genome map
AA seq 451 aa AA seqDB search
MSEVSKWPAINPFHWGYNGTVSHIVGENGSIKLHLKDNKEQVDFDEFANKYVPTLKNGAQ
FKLSPYLFTGILQTLYLGAADFSKKFPVFYGREIVKFSDGGVCTADWLIDSWKKDYEFDQ
STTSFDKKKFDKDEKATHPEGWPRLQPRTRYLKDNELEELREVDLPLVVILHGLAGGSHE
PIIRSLAENLSRSGRFQVVVLNTRGCARSKITTRNLFTAYHTMDIREFLQREKQRHPDRK
LYAVGCSFGATMLANYLGEEGDKSPLSAAATLCNPWDLLLSAIRMSQDWWSRTLFSKNIA
QFLTRTVQVNMGELGVPNGSLPDHPPTVKNPSFYMFTPENLIKAKSFKSTREFDEVYTAP
ALGFPNAMEYYKAASSINRVDTIRVPTLVINSRDDPVVGPDQPYSIVEKNPRILYCRTDL
GGHLAYLDKDNNSWATKAIAEFFTKFDELVV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagtttccaaatggccagcaatcaacccattccattggggatacaatggtaca
gtttcgcatattgtcggtgaaaatggttccattaaactccatttaaaagacaacaaggag
caagttgattttgacgagttcgctaacaaatatgtcccaacgttgaagaatggtgcccaa
ttcaaattgagtccttacttgttcacaggtattttgcaaactttgtacttaggtgctgct
gatttctctaagaaatttcctgtattctacggcagggaaattgtcaaattctcggatggt
ggagtttgcaccgctgactggctcatagattcatggaaaaaggattatgaattcgatcaa
agtactacgagctttgataaaaaaaaatttgataaagacgagaaggcgacacatccagaa
ggatggcctcgtttacaaccacgtacaaggtacctgaaagataatgagttggaagaacta
cgggaggttgatctacccctagtagttattctacatggtcttgctggtggtagtcatgag
ccgattataagatctcttgctgaaaacctgtctcgcagtgggagatttcaagtggtcgtc
ctaaataccagaggttgtgcacgttccaaaattaccaccagaaatttatttacagcttat
cacacaatggatattcgcgagtttttgcaaagagaaaagcaaagacatccagatagaaaa
ctatacgctgtgggatgctcttttggtgctacgatgctggcaaactatctgggagaagag
ggcgataaatcacctttatccgcagctgctactttgtgcaatccttgggatcttctcctt
tcagcaattaggatgagccaggattggtggtcaagaactttattttccaaaaatattgcg
caattcttaacaagaaccgttcaggttaatatgggtgaattaggagttccaaatggctct
ctccccgatcatcctcccacagtcaagaatccatctttctatatgttcacgcctgaaaat
ctaataaaggcaaagagctttaaatcgacccgggaatttgatgaagtgtacactgcgcct
gctttaggcttcccaaatgctatggagtattataaagcggccagctcaataaacagagtt
gatacaattcgggttcctacccttgttatcaattccagggatgatcctgttgtcggccca
gatcaaccatactcaatcgtggaaaagaatcctcgtattttgtattgtagaaccgattta
ggtggtcatttagcttacctagataaagacaacaactcgtgggctaccaaggcaattgca
gaatttttcactaagtttgatgaattagtcgtatga

DBGET integrated database retrieval system