KEGG   Saccharomyces cerevisiae (budding yeast): YBR195C
Entry
YBR195C           CDS       T00005                                 

Gene name
MSI1, CAC3
Definition
(RefSeq) Msi1p
  KO
K10752  histone-binding protein RBBP4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YBR195C (MSI1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     YBR195C (MSI1)
  Histone modification proteins
   HAT complexes
    HATB complex
     YBR195C (MSI1)
   HDAC complexes
    Sin3A-HDAC complex
     YBR195C (MSI1)
   Polycomb group proteins
    PRC2-EZH1 complex
     YBR195C (MSI1)
    PRC2-EZH2 complex
     YBR195C (MSI1)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    MIS16-MIS18 complex
     YBR195C (MSI1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    YBR195C (MSI1)
  Chromatin remodeling factors
   NuRD complex
    YBR195C (MSI1)
   NuRF complex
    YBR195C (MSI1)
   NuRF complex (fruit fly)
    YBR195C (MSI1)
SSDB
Motif
Pfam: CAF1C_H4-bd WD40 eIF2A ANAPC4_WD40 IKI3
Other DBs
NCBI-GeneID: 852494
NCBI-ProteinID: NP_009754
SGD: S000000399
UniProt: P13712
Position
II:complement(610614..611882)
AA seq 422 aa
MNQCAKDITHEASSIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSD
EHRILLSSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLV
NDISIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKL
FGSHGVIQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPII
DLPLVSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVN
SCRFNYKNSLILASADSNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAG
QEDGLVKLWDTSCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGNLVG
HS
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaatcagtgcgcgaaggacataactcatgaagcctccagtatacccatcgatttgcaa
gaaagatactcgcactggaagaaaaacactaaactactttatgattacctaaacacgaat
tcaacaaagtggccgtccttaacgtgccagttctttcctgatttagataccacttcggat
gagcatcgcatcttgttatcctcatttacatcttcccaaaaacctgaagatgagaccata
tatattagcaaaatatccacgttgggtcatataaaatggtcatctttaaataatttcgac
atggacgaaatggaattcaaaccggagaactcgacaaggtttccctccaaacacttagta
aatgacatcagtattttcttcccaaacggggaatgcaatagggcaagatatttgcctcaa
aatccagatattatagccggcgcctcttcagatggtgcaatctacatattcgatagaaca
aaacacggctctactagaataagacagtccaaaatttcacatccctttgagacaaagctg
tttggttcacatggtgttattcaagacgtggaggcaatggatacttcttcggcagatata
aatgaggcgacttctttagcctggaacttgcagcaggaggcccttttactttcttctcac
tccaacggccaagttcaagtttgggacattaaacaatattcgcatgagaaccctataata
gatttacccttagtgtcaataaacagcgacggaacagcggtgaatgatgtaacttggatg
ccaacacacgattccctctttgctgcttgtactgaaggaaatgcggtctccctattagat
ctgaggactaagaaagagaagctccagagtaaccgtgaaaaacacgatggtggagtaaac
tcctgtagatttaactataagaactctttaattctagcatctgcagattcaaatgggagg
ctaaatttatgggatattagaaacatgaacaaaagcccaatcgctaccatggagcacggt
acttccgtttcaactttagaatggagtccaaatttcgatactgtattggcaacggctggc
caagaagatgggttagtcaagctatgggatacctcctgcgaagaaactatatttacccat
ggtggtcatatgctcggtgtgaacgacatttcgtgggacgctcatgacccttggttaatg
tgcagtgtggcaaatgataattcagttcacatatggaaacctgcaggaaaccttgttgga
cattcgtga

DBGET integrated database retrieval system