KEGG   Saccharomyces cerevisiae (budding yeast): YDL126CHelp
Entry
YDL126C           CDS       T00005                                 

Gene name
CDC48
Definition
(RefSeq) AAA family ATPase CDC48
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDL126C (CDC48)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDL126C (CDC48)
   04131 Membrane trafficking [BR:sce04131]
    YDL126C (CDC48)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YDL126C (CDC48)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     YDL126C (CDC48)
Membrane trafficking [BR:sce04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    YDL126C (CDC48)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YDL126C (CDC48)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA AAA_lid_3 CDC48_N RuvB_N AAA_2 AAA_16 AAA_5 AAA_33 TIP49 CDC48_2 AAA_22 RNA_helicase AAA_14 Mg_chelatase Vps4_C IstB_IS21 ATPase AAA_18 AAA_24 AAA_7 ABC_tran Sigma54_activat AAA_25 Parvo_NS1 PhoH Bac_DnaA AAA_28 AAA_17 DUF815 AAA_3 TsaE AAA_11 ResIII DUF2075 UFD1 eIF-1a
Motif
Other DBs
NCBI-GeneID: 851431
NCBI-ProteinID: NP_010157
SGD: S000002284
UniProt: P25694
Structure
PDB: 

Position
IV:complement(236157..238664)
Genome map
AA seq 835 aa AA seqDB search
MGEEHKPLLDASGVDPREEDKTATAILRRKKKDNMLLVDDAINDDNSVIAINSNTMDKLE
LFRGDTVLVKGKKRKDTVLIVLIDDELEDGACRINRVVRNNLRIRLGDLVTIHPCPDIKY
ATRISVLPIADTIEGITGNLFDVFLKPYFVEAYRPVRKGDHFVVRGGMRQVEFKVVDVEP
EEYAVVAQDTIIHWEGEPINREDEENNMNEVGYDDIGGCRKQMAQIREMVELPLRHPQLF
KAIGIKPPRGVLMYGPPGTGKTLMARAVANETGAFFFLINGPEVMSKMAGESESNLRKAF
EEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRP
NSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMKLADDVDLEALAAETHGYVGAD
IASLCSEAAMQQIREKMDLIDLDEDEIDAEVLDSLGVTMDNFRFALGNSNPSALRETVVE
SVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGPPGTGKTLLAKA
VATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDELDSIAKARGGSL
GDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDE
NARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAIKDSIEAHRQHE
AEKEVKVEGEDVEMTDEGAKAEQEPEVDPVPYITKEHFAEAMKTAKRSVSDAELRRYEAY
SQQMKASRGQFSNFNFNDAPLGTTATDNANSNNSAPSGAGAAFGSNAEEDDDLYS
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagaacataaaccacttttggacgcctcgggtgtcgaccctcgtgaggaggat
aaaaccgccaccgccattttaagaagaaagaagaaggacaacatgcttttggtggacgat
gctatcaatgatgacaattctgtcattgctattaattctaacaccatggacaaattggaa
ttgttccgtggtgacaccgttctcgttaagggcaagaagagaaaagatactgtcttaatt
gtgttgatcgatgacgaattagaagacggagcatgcaggataaaccgtgtagttcgtaac
aatttacgtattaggctgggtgatttagttacaattcatccttgccccgatatcaaatac
gctactagaatttctgtgttaccaattgctgatacgatcgaaggtataactggtaatctt
ttcgatgtttttttgaagccttattttgtggaagcctacagaccagtgaggaaaggcgac
cattttgttgtcagaggcggtatgagacaagtcgaattcaaggttgtggatgtcgaacct
gaagaatatgccgtcgttgctcaggatactattattcactgggaaggtgagccaatcaac
agggaagatgaagaaaataatatgaatgaggtgggttacgatgatattggtggttgtcgt
aagcaaatggctcaaattagggaaatggttgaactaccattgagacatcctcagttgttc
aaggctatcggtatcaagccaccaagaggtgttttgatgtatggtccccctggtactggt
aaaaccttgatggcaagagctgttgctaatgagaccggtgccttttttttcttaattaat
ggtccagaagtcatgtcaaaaatggctggtgaatcagagtctaacttaagaaaggccttt
gaagaagccgaaaagaacgctccagccatcatttttatcgatgaaatcgattctatagct
ccaaagagagacaagactaatggtgaagttgagagaagagttgtctctcaattgttaact
ttaatggatggtatgaaggcaagatctaatgttgttgtcattgctgctaccaatagacca
aattcgattgatcccgctttaagaagatttggtagattcgatcgtgaagtcgacattggt
atcccagatgctacaggtagacttgaagttctacgtattcacaccaagaacatgaagttg
gctgatgatgttgatttggaagcattggctgctgaaacacacggttacgtgggtgctgat
attgcctctttgtgttctgaagctgccatgcaacagatccgtgaaaaaatggacttgata
gatttagatgaagatgaaattgatgcagaggtgctcgattctttaggagtcaccatggac
aacttcagattcgcattgggcaattcaaacccatctgcattgcgtgaaaccgttgttgaa
agtgtcaatgttacttgggatgacgttggtggcctagatgaaatcaaggaggaattgaag
gaaactgtagaatacccagtcttacatccagaccaatacacaaagtttgggttatcacca
tcaaagggtgtgttgttctacggtccaccaggtacaggtaaaactttgttagcaaaagct
gtagctactgaggtttctgccaactttatctcagtcaaaggtccagaattattgagtatg
tggtatggtgaatcggaatctaacatccgtgatatttttgataaggcaagagcagctgca
ccaaccgtcgtttttctagatgaattagactccattgccaaggcaagaggtggttccttg
ggtgatgctggtggtgcttcggatagagtcgtcaaccaactattaacagaaatggatggt
atgaatgctaagaaaaatgtgttcgtgattggtgccaccaataggccagatcaaattgat
cctgctattttaagacctggcagattggatcaattaatttatgttccattgccagatgaa
aacgctagattatctattctaaatgctcaattaaggaaaacaccactagaaccagggcta
gagttaactgcgattgccaaggccactcaaggtttctctggtgctgatttactctatatt
gtgcagagggctgctaaatacgctatcaaggattctatcgaagctcacagacaacacgaa
gctgaaaaggaagtgaaagtagaaggtgaagacgtggaaatgacagatgagggagcaaag
gctgaacaagaaccagaagtagatcctgttccatatattacaaaggagcatttcgcagaa
gctatgaagaccgctaaacgttctgtttcagatgctgaattgcgtcgttatgaagcatac
tcacagcaaatgaaagcatctagaggtcaattcagtaatttcaactttaatgacgctcca
ttaggtactacggctacggacaatgctaacagtaataatagtgctccaagtggagcaggt
gctgcatttggttctaatgcggaggaagatgatgatttgtatagttag

DBGET integrated database retrieval system