KEGG   Saccharomyces cerevisiae (budding yeast): YDR054C
Entry
YDR054C           CDS       T00005                                 

Gene name
CDC34, DNA6, UBC3
Definition
(RefSeq) SCF E2 ubiquitin-protein ligase catalytic subunit CDC34
  KO
K02207  ubiquitin-conjugating enzyme E2 R [EC:2.3.2.23]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YDR054C (CDC34)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDR054C (CDC34)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     YDR054C (CDC34)
Ubiquitin system [BR:sce04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   YDR054C (CDC34)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 851624
NCBI-ProteinID: NP_010339
SGD: S000002461
UniProt: P14682
Structure
PDB: 
6NYD 6NYA

Position
IV:complement(561440..562327)
AA seq 295 aa
MSSRKSTASSLLLRQYRELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFF
KAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEPDAETWSPVQT
VESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSKQDIPKGFIMPTS
ESAYISQSKLDEPESNKDMADNFWYDSDLDDDENGSVILQDDDYDDGNNHIPFEDDDVYN
YNDNDDDDERIEFEDDDDDDDDSIDNDSVMDRKQPHKAEDESEDVEDVERVSKKI
NT seq 888 nt   +upstreamnt  +downstreamnt
atgagtagtcgcaaaagcaccgcttctagcttactgttacggcaatatagagaacttact
gatcctaagaaagctattccctcatttcatatagaactagaggatgattcaaatattttc
acttggaacataggtgttatggtgctaaatgaggattccatttatcatggagggtttttc
aaagctcaaatgagatttccggaagactttcccttttctccaccacagtttcgatttacg
ccggctatctaccatccaaacgtttacagggatggcaggctttgtatttctattttacat
caaagtggggatcctatgaccgacgaacctgatgctgaaacgtggtcccccgtgcagacc
gtggaaagtgtgttgatctctatagtatctctattagaggaccccaatatcaactcgcca
gcaaatgtcgatgccgctgttgattacagaaagaaccctgaacaatacaagcaaagagtc
aaaatggaagtggaaagatcgaaacaagatatccctaaaggtttcataatgcccacttct
gaatcggcgtacatatctcaaagtaaactagatgaaccagaatcgaataaggatatggcg
gataatttttggtatgatagtgatttggacgacgatgagaacgggtccgtcattttacaa
gacgacgactacgacgatggaaacaaccatatcccctttgaagatgatgacgtttacaac
tataacgacaacgacgacgatgacgaaagaatcgaattcgaagatgatgacgatgatgac
gacgatagtatagataacgacagcgtcatggataggaaacaaccccacaaggctgaagat
gaaagtgaagatgtggaggatgtagaaagagtttcaaagaaaatataa

DBGET integrated database retrieval system