KEGG   Saccharomyces cerevisiae (budding yeast): YDR225W
Entry
YDR225W           CDS       T00005                                 
Symbol
HTA1, H2A1, SPT11
Name
(RefSeq) histone H2A
  KO
K11251  histone H2A
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR225W (HTA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YDR225W (HTA1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    YDR225W (HTA1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YDR225W (HTA1)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF LcrG YihI
Other DBs
NCBI-GeneID: 851811
NCBI-ProteinID: NP_010511
SGD: S000002633
UniProt: P04911
Structure
Position
IV:915530..915928
AA seq 132 aa
MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYL
AAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPK
KSAKATKASQEL
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtccggtggtaaaggtggtaaagctggttcagctgctaaagcttctcaatctagatct
gctaaggctggtttgacattcccagtcggtagagtgcacagattgctaagaagaggtaac
tacgcccaaagaattggttctggtgctccagtctacttgactgctgtcttggaatatttg
gccgctgaaattttagaattagctggtaatgctgctagggataacaagaagaccagaatt
attccaagacatttgcaattggctatcagaaatgatgacgaattgaacaagctattgggt
aacgttaccattgcccaaggtggtgttttgccaaacatccatcaaaacttgttgccaaag
aagtctgccaaggctaccaaggcttctcaagaattataa

DBGET integrated database retrieval system