KEGG   Saccharomyces cerevisiae (budding yeast): YER172CHelp
Entry
YER172C           CDS       T00005                                 

Gene name
BRR2, PRP44, RSS1, SLT22, SNU246
Definition
(RefSeq) ATP-dependent RNA helicase BRR2
  KO
K12854  pre-mRNA-splicing helicase BRR2 [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YER172C (BRR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YER172C (BRR2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YER172C (BRR2)
Spliceosome [BR:sce03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    YER172C (BRR2)
 Complex C
   U5 SnRNP specific factors
    YER172C (BRR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sec63 DEAD Helicase_PWI ResIII Helicase_C AAA_22 AAA_30 PhoH DUF87
Motif
Other DBs
NCBI-GeneID: 856919
NCBI-ProteinID: NP_011099
SGD: S000000974
UniProt: P32639
Structure
PDB: 

Position
V:complement(529530..536021)
Genome map
AA seq 2163 aa AA seqDB search
MTEHETKDKAKKIREIYRYDEMSNKVLKVDKRFMNTSQNPQRDAEISQPKSMSGRISAKD
MGQGLCNNINKGLKENDVAVEKTGKSASLKKIQQHNTILNSSSDFRLHYYPKDPSNVETY
EQILQWVTEVLGNDIPHDLIIGTADIFIRQLKENEENEDGNIEERKEKIQHELGINIDSL
KFNELVKLMKNITDYETHPDNSNKQAVAILADDEKSDEEEVTEMSNNANVLGGEINDNED
DDEEYDYNDVEVNSKKKNKRALPNIENDIIKLSDSKTSNIESVPIYSIDEFFLQRKLRSE
LGYKDTSVIQDLSEKILNDIETLEHNPVALEQKLVDLLKFENISLAEFILKNRSTIFWGI
RLAKSTENEIPNLIEKMVAKGLNDLVEQYKFRETTHSKRELDSGDDQPQSSEAKRTKFSN
PAIPPVIDLEKIKFDESSKLMTVTKVSLPEGSFKRVKPQYDEIHIPAPSKPVIDYELKEI
TSLPDWCQEAFPSSETTSLNPIQSKVFHAAFEGDSNMLICAPTGSGKTNIALLTVLKALS
HHYNPKTKKLNLSAFKIVYIAPLKALVQEQVREFQRRLAFLGIKVAELTGDSRLSRKQID
ETQVLVSTPEKWDITTRNSNNLAIVELVRLLIIDEIHLLHDDRGPVLESIVARTFWASKY
GQEYPRIIGLSATLPNYEDVGRFLRVPKEGLFYFDSSFRPCPLSQQFCGIKERNSLKKLK
AMNDACYEKVLESINEGNQIIVFVHSRKETSRTATWLKNKFAEENITHKLTKNDAGSKQI
LKTEAANVLDPSLRKLIESGIGTHHAGLTRSDRSLSEDLFADGLLQVLVCTATLAWGVNL
PAHTVIIKGTDVYSPEKGSWEQLSPQDVLQMLGRAGRPRYDTFGEGIIITDQSNVQYYLS
VLNQQLPIESQFVSKLVDNLNAEVVAGNIKCRNDAVNWLAYTYLYVRMLASPMLYKVPDI
SSDGQLKKFRESLVHSALCILKEQELVLYDAENDVIEATDLGNIASSFYINHASMDVYNR
ELDEHTTQIDLFRIFSMSEEFKYVSVRYEEKRELKQLLEKAPIPIREDIDDPLAKVNVLL
QSYFSQLKFEGFALNSDIVFIHQNAGRLLRAMFEICLKRGWGHPTRMLLNLCKSATTKMW
PTNCPLRQFKTCPVEVIKRLEASTVPWGDYLQLETPAEVGRAIRSEKYGKQVYDLLKRFP
KMSVTCNAQPITRSVMRFNIEIIADWIWDMNVHGSLEPFLLMLEDTDGDSILYYDVLFIT
PDIVGHEFTLSFTYELKQHNQNNLPPNFFLTLISENWWHSEFEIPVSFNGFKLPKKFPPP
TPLLENISISTSELGNDDFSEVFEFKTFNKIQSQVFESLYNSNDSVFVGSGKGTGKTAMA
ELALLNHWRQNKGRAVYINPSGEKIDFLLSDWNKRFSHLAGGKIINKLGNDPSLNLKLLA
KSHVLLATPVQFELLSRRWRQRKNIQSLELMIYDDAHEISQGVYGAVYETLISRMIFIAT
QLEKKIRFVCLSNCLANARDFGEWAGMTKSNIYNFSPSERIEPLEINIQSFKDVEHISFN
FSMLQMAFEASAAAAGNRNSSSVFLPSRKDCMEVASAFMKFSKAIEWDMLNVEEEQIVPY
IEKLTDGHLRAPLKHGVGILYKGMASNDERIVKRLYEYGAVSVLLISKDCSAFACKTDEV
IILGTNLYDGAEHKYMPYTINELLEMVGLASGNDSMAGKVLILTSHNMKAYYKKFLIEPL
PTESYLQYIIHDTLNNEIANSIIQSKQDCVDWFTYSYFYRRIHVNPSYYGVRDTSPHGIS
VFLSNLVETCLNDLVESSFIEIDDTEAEVTAEVNGGDDEATEIISTLSNGLIASHYGVSF
FTIQSFVSSLSNTSTLKNMLYVLSTAVEFESVPLRKGDRALLVKLSKRLPLRFPEHTSSG
SVSFKVFLLLQAYFSRLELPVDFQNDLKDILEKVVPLINVVVDILSANGYLNATTAMDLA
QMLIQGVWDVDNPLRQIPHFNNKILEKCKEINVETVYDIMALEDEERDEILTLTDSQLAQ
VAAFVNNYPNVELTYSLNNSDSLISGVKQKITIQLTRDVEPENLQVTSEKYPFDKLESWW
LVLGEVSKKELYAIKKVTLNKETQQYELEFDTPTSGKHNLTIWCVCDSYLDADKELSFEI
NVK
NT seq 6492 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcatgaaacgaaggataaggccaaaaaaattagagaaatttatcgttatgat
gagatgtccaataaggtgttgaaagttgataaacgctttatgaataccagccaaaatcct
caaagggatgcggaaatatcacaaccaaaatccatgagtggtagaattagtgctaaggat
atgggacagggcctgtgcaataacattaataaaggactaaaagaaaatgatgtagccgtt
gaaaaaactggaaagagcgcatcattgaaaaaaattcagcagcataacaccattttgaat
tcttcctccgatttcaggttacattattatccaaaggatccctcaaatgtcgaaacttac
gagcagattttgcagtgggttacagaagttttaggcaatgatataccccatgatcttatt
attggaactgctgatatattcatcagacaattgaaagaaaatgaggaaaatgaggatggt
aatattgaagagcgaaaggaaaagatccagcatgagctaggcatcaatatagactccctg
aagtttaacgaattagttaaacttatgaaaaacattaccgattatgaaacacatcctgac
aatagcaataaacaagcagtagcaattcttgccgatgatgaaaaatcagatgaagaagaa
gtaacagaaatgtccaacaatgctaatgttcttgggggagaaatcaatgataatgaagat
gatgatgaggaatatgattacaatgacgttgaagtcaattctaaaaaaaaaaacaagagg
gcattgccaaacattgaaaacgatataattaaactctccgatagtaaaacaagtaatatc
gagagcgttccgatatactcaatcgatgaattttttttgcagagaaaacttcggtcagag
cttggttacaaggatacctctgtaatacaagacctgtcagaaaaaattttgaatgatatt
gaaacacttgagcataatccagtagcgttggagcagaagttggttgatctgcttaaattc
gagaatatatcactggctgaatttattctcaagaatagatctacaattttttggggcata
cgactggcgaagagcacagagaatgaaataccgaacttaatagagaaaatggttgcaaaa
ggtttgaatgatcttgtggaacagtataaatttagagaaactacacactcaaagcgtgaa
ctcgattccggtgacgaccagccacagtcttcggaagcaaaaagaacaaaattcagtaat
ccagcaataccgcccgtcatagatttggaaaagattaaattcgacgaaagttctaaatta
atgaccgtgacaaaagtatccctaccggaaggatcattcaaaagggtgaaaccacaatat
gacgaaatacatattccagctcctagcaaacctgttattgattatgagttgaaagaaatt
acttctctaccagattggtgtcaggaggcgtttccttcatcggaaacaacgtccttaaac
cctatacaatcaaaggtttttcacgcagcatttgaaggtgattcaaacatgctaatatgt
gcacccactggttcaggtaagacgaatatcgcgttattgacggtattgaaagccttatcc
catcattataacccgaaaactaagaaattaaacctttctgcatttaaaattgtttatata
gcacccttgaaagccttagtacaggaacaagtccgagaatttcaaaggaggttggctttt
ctaggtataaaagtcgctgaattgactggtgattctaggcttagtagaaagcaaattgac
gagacgcaggttttggtgtctacgccagagaaatgggacataactactagaaattcaaat
aatttggccatcgtagaacttgttcgtttgttgattatagatgaaatacatttgttacat
gatgacaggggaccagtattggaaagcatcgtggctaggacattttgggcttccaaatat
ggccaggaataccccagaataataggcctttctgccaccttaccaaattatgaggatgtc
ggtaggtttttaagagttccgaaggaaggattgttttattttgactcctcatttagaccg
tgtcctctatctcaacagttttgtggcattaaggaacggaactccttgaaaaagctgaag
gctatgaatgatgcttgttatgaaaaggtattggaatccatcaatgaaggtaatcaaata
atcgtgtttgttcattctcgaaaagaaacatcacgaacagcaacatggttgaaaaataaa
tttgctgaagagaacattactcataaattaaccaaaaatgatgcaggatcgaagcagatt
ttaaagacagaagcagccaacgtactcgatccaagtctacgaaagttgattgaaagcggt
atagggacgcatcacgcagggctgaccagaagtgacagatccttatctgaagatttattt
gcagacgggttgttgcaagtattggtatgcactgcgacgttagcatggggtgttaatcta
cctgctcatacagtgattataaaaggaacagatgtctattcacctgaaaaggggtcctgg
gaacaactttctccacaagatgtacttcaaatgttaggtagagcaggcagaccgagatat
gacacatttggcgagggtattataataacagaccaatcgaatgttcaatattatctctcg
gttttaaatcaacaattaccaatagaatcgcaatttgtttcaaaattagttgacaactta
aatgcagaagttgtcgcgggtaacattaagtgcaggaatgatgctgtgaattggttggcg
tatacttacctatatgtcagaatgttagcttcccctatgctttacaaagtacctgatatt
tcaagtgatgggcaattgaaaaagtttagagaaagcttagtccattcggccctatgcatt
ttaaaagaacaagagttggtgttatatgatgctgaaaatgatgtaattgaggcgaccgat
ctaggaaatatagcgtcgtcattttacataaatcatgcttccatggatgtttacaataga
gagttagatgaacatacaactcagattgatctttttagaatattctcaatgtcggaagag
tttaagtacgtatcggtgagatatgaagagaaaagagaactaaaacaacttctagagaaa
gcacccattcctatcagagaagatattgatgatcctttagcaaaagtgaatgtactactg
cagtcttatttttcccagctaaagttcgaaggttttgcacttaattctgatatagtgttt
attcaccaaaatgctggtaggttattgcgtgctatgtttgaaatatgcttgaagagagga
tggggacatcccacacggatgttgttaaatctttgcaaatctgccacaactaaaatgtgg
ccaacaaactgtcctttaagacagtttaaaacatgccctgtcgaagtgattaaaaggctg
gaagcctctacagtaccgtggggagattatctacagctagaaacacctgccgaagttggt
cgtgcaatcagatctgaaaaatatggaaaacaggtttacgatttattgaaaagatttccc
aaaatgtccgtaacatgcaacgctcagccaattacccgtagcgttatgaggttcaacatt
gaaataatagccgactggatatgggatatgaatgtacacggttcccttgaaccttttttg
ctcatgctagaagacactgatggtgattcaatactttattatgacgtactattcatcact
ccagatatagttggtcatgaatttaccttatcctttacttatgagttaaagcagcacaat
caaaataacttaccacctaatttcttccttactttgatatcagaaaattggtggcacagt
gaattcgagattccagtttccttcaatggatttaaacttccgaaaaaatttcctcctcct
actccccttctggagaatattagtatttcaacatcagagcttggcaatgatgatttttcc
gaagtatttgaatttaaaactttcaacaagattcagagccaggtcttcgagtctctctac
aattcgaatgactcggtctttgtaggttcaggaaagggcacaggtaaaacagctatggct
gaattagcactgttaaatcattggagacagaataaaggaagagcggtttatatcaatccg
tctggggaaaaaattgattttttgctatctgattggaataaaaggttctctcatcttgct
ggtggtaagataataaataagctaggaaatgatccttcactaaatttaaaattattagca
aaaagccatgttctcttggctacccccgtgcaatttgagcttttgtcacgtcgttggaga
caaaggaagaacatccaaagtttagaattaatgatatatgatgacgctcatgagattagc
caaggtgtttacggtgctgtgtatgaaacgctaatttctagaatgatatttatagcaacc
caacttgaaaagaaaattcgatttgtttgcctttcgaactgtttggcaaatgctcgtgat
tttggtgaatgggctggtatgacgaagtcaaacatctacaacttttctccaagcgaaaga
attgagcctcttgaaattaatattcagtcatttaaagatgttgagcacatatcattcaat
ttttcgatgcttcaaatggcatttgaagcatctgctgctgcagcgggaaatcgtaattcc
agttcggtgttcttaccatctagaaaggattgtatggaagttgcgtctgcatttatgaag
ttttcaaaagcaattgaatgggatatgttgaacgttgaagaagagcaaattgtaccatac
attgaaaagttaacagatggtcatctaagagcacctttaaaacacggtgttggtattttg
tataaggggatggcatcaaatgatgaaagaattgtgaaaaggttatacgaatatggtgcg
gtatcggttttactcatttctaaggattgttctgcattcgcttgtaaaactgatgaagtg
attattttaggaaccaacctttatgatggtgcagagcataaatatatgccatataccata
aatgaacttctagaaatggtgggactagctagtggtaacgattcaatggcaggcaaggtt
ttaattttgacaagtcacaacatgaaggcctactacaaaaaattcttaattgagcctttg
cctactgagagttacctacagtatattattcatgatactctgaacaacgagatagcaaat
tctattatacaaagcaaacaagattgtgttgactggtttacatattcgtatttctatcgt
cgtatccatgtgaatccaagctattatggcgtaagggatacgtctccacatggaatttca
gtttttttgagtaatttagttgaaacttgtttgaatgacttagttgaatcatccttcatt
gaaattgacgatacagaagctgaagtaaccgcagaagttaatggaggagatgatgaagca
actgaaatcatttctaccttgagcaacgggctaattgcttctcactatggcgtatcattt
tttactattcagtcattcgtttcttctttatcgaatacgtcaacgctcaaaaacatgctg
tatgttctttcaacagcagtagaattcgaaagtgttccactcagaaaaggagacagagca
ttacttgtcaaattaagtaaaagactaccattgagattccctgaacacacctcttctggt
tcggtgagctttaaagttttcttattgttacaagcatatttttcacgtcttgaattacct
gtcgactttcaaaatgatttaaaagacattctagaaaaggttgttccactaattaacgta
gtggttgatatcctttcagcaaacgggtatttgaatgctactaccgccatggatttggcg
cagatgttgattcagggtgtatgggacgttgataatccgttgagacagattccacacttc
aacaacaaaattttggaaaaatgtaaagaaattaacgtcgagacggtctatgatataatg
gcccttgaggatgaagagagggatgaaattttaacgcttactgattcacagcttgcgcag
gtcgccgcgtttgttaacaattaccccaacgttgaacttacttattcgttgaataattct
gattcgttaatttcaggtgtaaaacagaaaattaccattcaattgacaagagatgttgaa
cctgagaacttacaagtaacatctgaaaagtatccgtttgataagctagaaagttggtgg
ttggttttaggtgaagtatctaaaaaagagctttatgcgatcaagaaagttactttaaat
aaagagactcagcaatatgaattggaatttgacactccgacatctggtaaacataactta
acaatttggtgtgtctgtgattcatatcttgacgcagataaagagttgtcctttgaaata
aatgtgaaataa

DBGET integrated database retrieval system