KEGG   Saccharomyces cerevisiae (budding yeast): YFL002CHelp
Entry
YFL002C           CDS       T00005                                 

Gene name
SPB4
Definition
(RefSeq) putative ATP-dependent RNA helicase SPB4
  KO
K14809  ATP-dependent RNA helicase DDX55/SPB4 [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YFL002C (SPB4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YFL002C (SPB4)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-60S particles
   Helicases
    YFL002C (SPB4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII ERCC3_RAD25_C
Motif
Other DBs
NCBI-GeneID: 850549
NCBI-ProteinID: NP_116654
SGD: S000001894
UniProt: P25808
Position
VI:complement(145114..146934)
Genome map
AA seq 606 aa AA seqDB search
MSKSLEWDNLGFSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAA
FVIPVLEKVVKEEANTSKFKKAHFHSLIIAPTRELSRQIESVVLSFLEHYPSDLFPIKCQ
LLVGTNEATVRDDVSNFLRNRPQILIGTPGRVLDFLQMPAVKTSACSMVVMDEADRLLDM
SFIKDTEKILRLLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKLNY
CVVNPAEKLQLLVSILNNYKFKKCIVYFPTCVSVSYFYSFIQYLGKRNILVNEVEIFSLH
GKLQTSARTKTLTAFTDSLSNSVLFTTDVAARGIDIPDVDLVIQLDPPTNTDMFMHRCGR
TGRANRVGKAITFLNEGREEDFIPFMQVKNVELEELDLEVKGITTNFYEDFRNWILEDRD
RFDKGVKAYVAFIKYYSNHSATSIFRLQSLDYVGIAKLYGLFRLPRMPEITKYLATEKQE
GIFPGNWLVDPPVNMDEYKYKDKKREKERQETLKNISLINDKKKLKSELKKKNLAWSDKT
LTKERKLERKEKMSLKRKAIEEELKAEELDENAEEERIKEDWKEIVLQNKRKKVSSKAIQ
GNFDDL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtcattggaatgggataatctcgggttttctttacttccctggataaggaca
ggactcgatgttatgggttttgagaccatgactccagtccaagcatcgacaattcccatg
cttgctggcaacaaggatgtagtagttgattctgtaacaggctcaggtaagaccgctgcg
tttgttatacctgtactagaaaaagttgtaaaggaagaagcgaatacatcaaaattcaag
aaagcacacttccactcgttaattattgctccaacaagagaattgtcacgccaaattgag
tctgtcgttctatcatttctggaacattatccttccgacttgttccctattaaatgtcag
ctcctggttggtactaatgaagccacagttagagatgatgtaagtaattttctgcggaat
agaccgcagattctgattggaacacctggtagagttttggactttttacaaatgccagca
gtaaagacgtcagcatgcagtatggtagttatggatgaagcagacagattgttggatatg
agttttattaaggataccgaaaaaattctgaggctattgcctaaacaaagaaggacgggt
ctattttctgcaactatgcgtagcgccggatcagatatctttaagacagggcttagaaat
cctgtcaggattaccgttaactctaagaaccaggcgccctcctctttgaaattaaattac
tgtgtcgtaaatcctgccgaaaaactacaacttttggttagcattttgaataactacaaa
ttcaagaaatgtattgtatattttccaacatgtgtgtcagtctcctacttctactcattt
atccagtatttgggaaagaggaatattctcgtgaatgaagtagaaatattttccttgcat
ggaaaacttcaaacatcggcaaggacaaaaactctaacagcttttactgattcgctaagt
aattctgttttattcacaacagatgtggctgctagaggtattgacatacccgacgttgat
ctcgtcatccagcttgatccccctaccaatactgatatgttcatgcatagatgtggtaga
actggtagagcaaatagagtgggtaaagcaattacgtttcttaatgaaggcagagaagag
gattttattcctttcatgcaagttaaaaatgtggaacttgaagaacttgatttggaagta
aagggcataacaacaaacttttacgaggactttagaaattggatactagaagatagggat
agatttgataaaggtgttaaagcatatgttgcctttattaaatactactcaaatcattcc
gcaacttcaatttttaggcttcaatctttagattatgttggtattgcgaaattgtatggt
cttttccgcctgcctagaatgcctgagataacaaagtacttagccaccgaaaaacaagaa
gggattttcccagggaattggttggtcgatcccccagttaatatggatgaatataaatac
aaggacaaaaaacgtgaaaaggagagacaagaaacattaaaaaatataagcctgattaat
gataaaaagaagctgaaaagtgagttgaagaagaagaatttagcgtggtcagataaaaca
ttgacgaaagaacggaaactcgagagaaaggaaaagatgagtttaaaaaggaaggctata
gaggaagaattgaaagcagaagagctcgatgaaaatgctgaagaagagcgtattaaagag
gattggaaagaaatcgttttacagaataaacggaagaaagtttccagcaaagctatccaa
ggcaattttgacgacttataa

DBGET integrated database retrieval system