KEGG   Saccharomyces cerevisiae (budding yeast): YGR263C
Entry
YGR263C           CDS       T00005                                 

Gene name
SAY1
Definition
(RefSeq) steryl deacetylase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Say1_Mug180 Abhydrolase_3 Esterase
Other DBs
NCBI-GeneID: 853179
NCBI-ProteinID: NP_011779
SGD: S000003495
UniProt: P53324
Position
VII:complement(1017967..1019241)
AA seq 424 aa
MAANSGLDSKVEYYRLQENEIISAVSSEDADQNDAGFRLSTIHLHLFHGLKFAALLFTVV
PVFIILDSMKIIFQRKRRFCLDHVNRSFLRQSSWILDERICQYVLNPLFVCLYPSTFSSP
TYVKCNIPIEDQKSPENNIFQDHQLNAPKIVSTKFYQYVMPEGFDPTTDPVLVFYHGGGY
ALKLTPTSFSFLNNMRNAFPKMAILVPDYTVTATDDQSKKYPLQILQNVAIFDYVVKTMG
CKNVVIMGDSAGGNAVLNIVLYLRKCHREIYPKKVIAISPWANATFFHEGEKEYMQGTQE
WDGLCLKSHSMFGRMFVGNNPNVDFTSDPFVNIEKNFETKMWQDILKKCSVMITYGSDEL
LSFQNKILAKKMSDASEGCNHFTAKNVLVEHQGYHTGPILNYSRNMDRWTNIPSIARILE
FMQS
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcagccaactctggtctcgactcaaaagttgaatattatcggcttcaagagaatgaa
attattagcgctgtatcaagtgaggatgcagatcaaaatgatgcgggctttcgattgagt
accatccatttgcatttgttccatggattgaaatttgccgctctattgttcacagtggtg
cctgtatttataatcctcgacagtatgaagatcatttttcaacgcaaacgtaggttttgc
cttgaccatgtcaacagaagttttttaagacaaagttcttggatcctcgatgaacgcatc
tgtcaatacgtgctcaatcctttatttgtttgtttatatccttctacattttctagtcca
acatatgtcaaatgcaacattcctatagaagatcagaaatctccagaaaacaatattttc
caagaccatcaattaaacgcacccaaaatagttagcacaaagttttatcaatatgttatg
ccggaaggatttgaccccacgacagatccagttttagtattctatcatgggggtggttat
gctcttaaattgacgcctacgtcgttttctttcttgaataatatgcgaaatgcctttcct
aaaatggccattcttgtaccagattataccgttacagctaccgatgaccagtcgaaaaag
taccctctgcaaattttacaaaatgtggccatttttgattacgttgttaagactatgggg
tgcaaaaatgtagtgattatgggggattctgctggtggcaatgctgttttgaacattgtt
ttatatttaagaaagtgtcacagagaaatatacccgaaaaaagtcatagccataagtccc
tgggccaatgccactttcttccacgagggagaaaaggaatatatgcaaggaacacaagaa
tgggatggtctatgtttgaagagtcattcgatgtttgggcgaatgtttgtaggaaacaac
ccaaacgtcgattttaccagcgacccttttgttaatattgaaaagaatttcgaaactaaa
atgtggcaagatattctgaaaaagtgctctgtgatgattacttatggtagtgatgagttg
ttgagctttcaaaacaagatcttggcaaagaaaatgagtgacgctagcgagggatgtaac
cactttaccgccaaaaatgtgctggttgaacaccaaggttatcatacgggcccaatatta
aactactctcgtaatatggatcgctggaccaacataccatctatcgctcgcattcttgag
tttatgcaatcctga

DBGET integrated database retrieval system