KEGG   Saccharomyces cerevisiae (budding yeast): YGR271WHelp
Entry
YGR271W           CDS       T00005                                 

Gene name
SLH1
Definition
(RefSeq) putative RNA helicase
  KO
K18664  antiviral helicase SLH1 [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGR271W (SLH1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YGR271W (SLH1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     YGR271W (SLH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sec63 DEAD ResIII Helicase_C AAA AAA_19 Helicase_PWI PhoH MotA_ExbB
Motif
Other DBs
NCBI-GeneID: 853187
NCBI-ProteinID: NP_011787
SGD: S000003503
UniProt: P53327
Position
VII:1031791..1037694
Genome map
AA seq 1967 aa AA seqDB search
MSTEYSADSSKSFMIAMQSMIDTSQTFNLDRSKISLPDFDDELKKVQKDEQNQRTELTVL
SQDRNDWDDIFEEFKDISFAQLQSIIDSYKTKNAVAVYKKIGKLINEAETTLSSNVLLET
VLQMVYKHQKQELEKELLDFLGTGNIDLVSLLLQHRRMIVATPIETTILLIKNAVNSTPE
FLTQQDIRNQVLKSAEDAKNRKLNPATKIIKYPHVFRKYEAGSTTAMAFAGQKFTLPVGT
TRMSYNTHEEIIIPAADQASNKNYLYTKLLKISDLDHFCKTVFPYETLNQIQSLVYPVAY
KTNENMLICAPTGAGKTDIALLTIINTIKQFSVVNGENEIDIQYDDFKVIYVAPLKALAA
EIVDKFSKKLAPFNIQVRELTGDMQLTKAEILATQVIVTTPEKWDVVTRKANGDNDLVSK
VKLLIIDEVHLLHEDRGSVIETLVARTLRQVESSQSMIRIIGLSATLPNFMDVADFLGVN
RQIGMFYFDQSFRPKPLEQQLLGCRGKAGSRQSKENIDKVAYDKLSEMIQRGYQVMVFVH
SRKETVKSARNFIKLAESNHEVDLFAPDPIEKDKYSRSLVKNRDKDMKEIFQFGFGIHHA
GMARSDRNLTEKMFKDGAIKVLCCTATLAWGVNLPADCVIIKGTQVYDSKKGGFIDLGIS
DVIQIFGRGGRPGFGSANGTGILCTSNDRLDHYVSLITQQHPIESRFGSKLVDNLNAEIS
LGSVTNVDEAIEWLGYTYMFVRMRKNPFTYGIDWEEIANDPQLYERRRKMIVVAARRLHA
LQMIVFDEVSMHFIAKDLGRVSSDFYLLNESVEIFNQMCDPRATEADVLSMISMSSEFDG
IKFREEESKELKRLSDESVECQIGSQLDTPQGKANVLLQAYISQTRIFDSALSSDSNYVA
QNSVRICRALFLIGVNRRWGKFSNVMLNICKSIEKRLWAFDHPLCQFDLPENIIRRIRDT
KPSMEHLLELEADELGELVHNKKAGSRLYKILSRFPKINIEAEIFPITTNVMRIHIALGP
DFVWDSRIHGDAQFFWVFVEESDKSQILHFEKFILNRRQLNNQHEMDFMIPLSDPLPPQV
VVKVVSDTWIGCESTHAISFQHLIRPFNETLQTKLLKLRPLPTSALQNPLIESIYPFKYF
NPMQTMTFYTLYNTNENAFVGSPTGSGKTIVAELAIWHAFKTFPGKKIVYIAPMKALVRE
RVDDWRKKITPVTGDKVVELTGDSLPDPKDVHDATIVITTPEKFDGISRNWQTRKFVQDV
SLIIMDEIHLLASDRGPILEMIVSRMNYISSQTKQPVRLLGMSTAVSNAYDMAGWLGVKD
HGLYNFPSSVRPVPLKMYIDGFPDNLAFCPLMKTMNKPVFMAIKQHSPDKPALIFVASRR
QTRLTALDLIHLCGMEDNPRRFLNIDDEEELQYYLSQVTDDTLKLSLQFGIGLHHAGLVQ
KDRSISHQLFQKNKIQILIATSTLAWGVNLPAHLVIIKGTQFFDAKIEGYRDMDLTDILQ
MMGRAGRPAYDTTGTAIVYTKESKKMFYKHFLNVGFPVESSLHKVLDDHLGAEITSGSIT
NKQEALDFLSWTFLFRRAHHNPTYYGIEDDTSTAGVSEHLSSLIDSTLENLRESQCVLLH
GDDIVATPFLSISSYYYISHLTIRQLLKQIHDHATFQEVLRWLSLAVEYNELPVRGGEII
MNEEMSQQSRYSVESTFTDEFELPMWDPHVKTFLLLQAHLSRVDLPIADYIQDTVSVLDQ
SLRILQAYIDVASELGYFHTVLTMIKMMQCIKQGYWYEDDPVSVLPGLQLRRIKDYTFSE
QGFIEMTPQQKKKKLLTLEEIGRFGYKKLLNVFDQLTFGMTESEDTKKRFVSVCQRLPVL
EGMKFEEQENNEVLTFYSKHLSSKHNNGFEVYCDKFPKIQKELWFLIGHKGDELLMIKRC
QPKQMNKEVIIHCDLFIPEEIRGEELQFSLINDALGLRYDMVHKLIS
NT seq 5904 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgaatactctgctgattcatctaaatcatttatgattgcaatgcaatctatg
attgatacttcacaaacctttaatctagatagatcgaaaatctctttaccagattttgat
gacgagctaaaaaaagtccaaaaggatgaacaaaatcaaagaactgaactaactgttctc
tcacaagatagaaatgattgggatgatatatttgaggagtttaaagacatttcatttgct
caactgcaatctataattgattcatacaaaacaaagaatgcagttgcagtatataaaaaa
attggaaaactaatcaatgaagctgaaacgacactaagcagcaatgtattattagaaact
gtactgcaaatggtttataaacatcaaaagcaagagttagagaaagaattgttggatttt
ttaggaacagggaatatagaccttgtttctctgttacttcagcatagaagaatgatcgtt
gctacacctatagaaacgacgattctgctaataaaaaatgcggtcaattcaacgccagag
ttcctgacacagcaagatatcaggaatcaagttttgaaaagtgcagaggatgccaagaat
aggaaattaaatcccgccactaaaataatcaagtacccacacgtcttcagaaaatatgaa
gcaggatccactacagctatggcctttgccggtcaaaaattcactttgccagtagggact
acaaggatgtcgtacaatacccatgaagaaattataattccggcagcagatcaggcatcc
aacaagaactatctctatacaaaactattgaaaataagtgatttggatcatttttgcaag
actgtatttccctatgaaactttaaaccaaatacaatcccttgtttaccccgtagcttat
aaaacaaatgaaaatatgctaatttgtgcacctactggtgcaggtaaaacagacattgca
ttactgacaataattaatacaataaaacaattctccgtggtcaacggggaaaatgaaatt
gatattcaatatgatgattttaaagttatttatgttgcccctttgaaagcactcgctgct
gaaatcgtcgacaagtttagtaagaaattggcgccttttaatatacaagtaagggagtta
acaggcgatatgcaattgacaaaggcggaaattttagccactcaagtaatagtcacaacc
cctgagaaatgggacgttgtcacccgtaaagcaaacggcgacaacgatttggtttcaaag
gtcaaattactaattattgatgaagttcatttactgcacgaagatagaggttcggttatt
gaaactttagttgcacgtaccttgagacaggtagaaagctctcaatcaatgattcgtatt
atcggtctatcagctacattacccaattttatggatgtagcagatttcttaggagtaaat
agacagatcggaatgttctattttgatcaatcattccgtccaaagcctctagagcagcaa
cttttgggctgtagaggtaaggcaggtagtagacaaagtaaagagaatatcgataaagtc
gcttacgacaaattgagtgaaatgattcaaagagggtaccaggtaatggtatttgtccac
tcaagaaaggaaactgttaaaagtgcaagaaactttatcaaactagcagaatctaaccac
gaagttgacctttttgcacctgaccctatcgaaaaggataaatattctagaagtttagtg
aagaacagagacaaggatatgaaggagatttttcaatttggttttggtatccatcatgct
ggtatggcccgttcagatagaaatcttactgaaaaaatgtttaaagacggtgctatcaag
gtactgtgttgtactgcaacattagcatggggtgttaatttacctgctgattgtgttatc
atcaagggtacacaagtatatgattctaaaaagggtggattcatagatctaggtatttca
gatgttattcagatttttggcaggggtggtaggccgggcttcggttccgcaaatggtacg
ggtattttatgtacttccaatgatcgtctggatcattatgtttccttaattactcaacaa
caccctatcgaatctagattcggttccaagttggttgataacctgaacgccgaaatttca
ttggggagcgtgacaaatgtagatgaagcaatcgaatggcttggttacacatacatgttt
gttcgtatgagaaaaaatccttttacttacggtattgattgggaggaaattgcaaatgac
ccgcaattatatgaacggaggagaaaaatgatcgtagtagctgcaaggcgattacatgct
ctccaaatgattgtgttcgatgaagtgtcaatgcatttcattgcaaaggatttgggcagg
gtgtcctctgatttttatcttttgaacgaatccgtcgagatattcaatcaaatgtgtgat
cccagagccaccgaagctgatgtattgtccatgatcagtatgagcagtgaatttgacggt
ataaaatttagagaagaagaatccaaggagttgaagagactttctgatgaatctgttgag
tgccagattggaagccaacttgacacccctcaaggtaaagcaaacgtgctattacaggct
tatatttcccagactagaatttttgactcagcactatcatccgattcgaattatgttgct
cagaactctgttagaatttgtagagcattgtttttaataggtgtcaatagaagatggggt
aaattttcaaacgtcatgctaaatatttgcaaatctattgaaaagaggctctgggccttt
gatcaccctctctgtcagtttgatttgcctgaaaatattatcagacgcatcagagatact
aaaccttccatggagcatcttttagaattagaggcagatgagctcggagagctggtgcat
aataagaaggccgggtctaggttatataaaatattgagccgatttccaaagattaatata
gaagctgagattttccccattacaacaaatgtaatgaggatacatattgcattaggtcca
gactttgtatgggattcccggatacatggtgatgcacagtttttttgggttttcgttgaa
gaatctgataagtcgcaaatccttcattttgaaaagttcatcttaaacagaaggcagttg
aataatcagcatgaaatggacttcatgatcccattgtcagaccctttgcctccgcaggtt
gtcgtaaaggttgtgtcggatacttggattggctgtgaatcgacccatgccatctctttt
caacatttaatcagaccatttaacgaaactttacagacaaaattgttgaagttacgtcct
ctacctacatcagccctccagaatcctttaattgagtcaatttatcctttcaagtatttc
aatcccatgcaaactatgacattttatacactttacaataccaatgagaatgcgtttgtt
ggctcgcctacaggttctggtaaaacgattgtggctgaattggctatatggcatgccttc
aaaacatttcctgggaaaaagattgtttatatcgcaccaatgaaagcattagtacgtgaa
agggttgatgactggagaaagaaaataacaccagtgaccggagataaagttgtagagtta
accggtgattctttgccagatcctaaagatgtgcatgatgccaccattgttattacaact
ccagaaaagtttgatggtatttcccgtaattggcaaactcgtaagtttgttcaagatgta
tctttaattatcatggatgaaattcatttgttggctagtgatcgtggtcctatcttagaa
atgattgttagtcgtatgaattatatttcctctcaaaccaagcaaccggtcagactgcta
ggtatgtcaactgctgtttcaaacgcctacgacatggctggctggttgggagttaaggac
cacggactgtataacttcccgtcaagcgtccgtccggttccattgaaaatgtacattgat
ggatttccagataatttggcattctgtcctctgatgaaaacaatgaacaaacctgtgttt
atggccattaaacaacattcacctgataaaccagcattaatatttgttgcatcgcgtaga
caaactagactaacggctttagacttgatccacttatgtggaatggaagataatccacgt
aggtttttgaatatagacgatgaggaggaactgcaatattacttatcacaggtcactgac
gacactttaaagttatcactccagttcggtattggattgcatcatgcaggtctagtgcaa
aaagatcgttctatttctcatcagttgtttcaaaaaaacaaaattcagattctgatcgct
acatcaaccctagcgtggggtgtcaatttgccagctcacttggttatcatcaaaggtaca
caattttttgatgcaaaaattgaaggatatagagatatggatttaacagatatcttgcaa
atgatggggagagctggtagaccggcttatgacactacaggtactgctatcgtttataca
aaagagtccaaaaaaatgttttataaacatttcctaaacgttggttttcctgtcgagtcc
tccttgcacaaggtattagatgatcatttaggtgcagaaataacgtcaggtagcataact
aataagcaagaagcgttagattttttgagttggacatttttgtttcgtagagcgcatcat
aacccgacatattatggcattgaagatgatacaagtacagcaggagtcagtgaacatttg
agttctttgatagatagcacattagaaaatctgcgagaatcacaatgtgttttattacat
ggagatgatattgttgctacgccattcttaagtatatcctcatactactatatttcacat
ttaacgatacgccaattattgaaacagatacatgatcatgcgacttttcaagaggtatta
cgatggttatcgttggctgttgagtataatgaattgcctgtaagaggtggtgaaattatc
atgaatgaagaaatgtcgcagcaatcgaggtactccgttgaaagcacttttaccgatgaa
ttcgaattaccgatgtgggatccacatgtaaaaacatttttattacttcaagctcattta
agccgtgtagatttaccgattgcagattatatccaggataccgtatcagttttggatcaa
tctctacgtattctacaggcttatattgatgtcgccagtgaattgggttactttcatacg
gtattgaccatgataaagatgatgcaatgcataaagcaagggtattggtatgaagacgat
cctgttagtgtacttccaggattacaactgagaagaatcaaagattacacttttagcgag
caggggttcattgaaatgacgccgcagcaaaagaagaaaaagctgttaaccttggaggaa
ataggaaggtttggatataagaaattattaaatgtttttgatcaactaacttttggaatg
acagaaagcgaagatacgaaaaaacgtttcgtcagtgtctgccaaagattaccggtttta
gaaggcatgaaatttgaagaacaggaaaataacgaggtgttaacattttatagcaagcac
ctttctagtaagcataataatgggtttgaagtatattgtgataaattccctaagatacaa
aaagaactatggtttttaattggacacaaaggcgatgaactgctgatgattaaaaggtgt
caaccaaaacaaatgaataaagaggtcataatacattgtgatctatttattcccgaagaa
attcgtggcgaagaattgcaattttcccttattaatgacgctttaggattacgttatgat
atggtccataaactaatctcttag

DBGET integrated database retrieval system