KEGG   Saccharomyces cerevisiae (budding yeast): YIL075C
Entry
YIL075C           CDS       T00005                                 

Symbol
RPN2, SEN3
Name
(RefSeq) proteasome regulatory particle base subunit RPN2
  KO
K03032  26S proteasome regulatory subunit N2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03050  Proteasome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    YIL075C (RPN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sce03051]
    YIL075C (RPN2)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     YIL075C (RPN2)
SSDB
Motif
Pfam: RPN2_C PC_rep HEAT_2 HEAT_EZ HEAT Ribosomal_60s RICTOR_V DUF3824
Other DBs
NCBI-GeneID: 854735
NCBI-ProteinID: NP_012190
SGD: S000001337
UniProt: P32565
Structure
PDB: 

Position
IX:complement(217863..220700)
AA seq 945 aa
MSLTTAAPLLALLRENQDSVKTYALESINNVVDQLWSEISNELPDIEALYDDDTFSDREM
AALIASKVYYNLGEYESAVKYALAAKDRFDIDEKSQFVETIVSKSIEMYVQEASKQYTKD
EQFYTKDIIDPKLTSIFERMIEKCLKASELKLALGIALEGYRLDIIESALKSKLDQDSTS
ENVKIINYLLTLAITTVTNSKFRSSILRKSFDFLMNMPNCDYLTLNKVVVNLNDAGLALQ
LFKKLKEENDEGLSAQIAFDLVSSASQQLLEILVTELTAQGYDPALLNILSGLPTCDYYN
TFLLNNKNIDIGLLNKSKSSLDGKFSLFHTAVSVANGFMHAGTTDNSFIKANLPWLGKAQ
NWAKFTATASLGVIHKGNLLEGKKVMAPYLPGSRASSRFIKGGSLYGLGLIYAGFGRDTT
DYLKNIIVENSGTSGDEDVDVLLHGASLGIGLAAMGSANIEVYEALKEVLYNDSATSGEA
AALGMGLCMLGTGKPEAIHDMFTYSQETQHGNITRGLAVGLALINYGRQELADDLITKML
ASDESLLRYGGAFTIALAYAGTGNNSAVKRLLHVAVSDSNDDVRRAAVIALGFVLLRDYT
TVPRIVQLLSKSHNAHVRCGTAFALGIACAGKGLQSAIDVLDPLTKDPVDFVRQAAMIAL
SMILIQQTEKLNPQVADINKNFLSVITNKHQEGLAKFGACVAQGIMNAGGRNVTIQLENA
DTGTLDTKSVVGLVMFSQFWYWFPLAHFLSLSFTPTTVIGIRGSDQAIPKFQMNCYAKED
AFSYPRMYEEASGKEVEKVATAVLSTTARAKARAKKTKKEKGPNEEEKKKEHEEKEKERE
TNKKGIKETKENDEEFYKNKYSSKPYKVDNMTRILPQQSRYISFIKDDRFVPVRKFKGNN
GVVVLRDREPKEPVALIETVRQMKDVNAPLPTPFKVDDNVDFPSA
NT seq 2838 nt   +upstreamnt  +downstreamnt
atgtctttgacgactgctgctcctcttttagcattgttgagagagaatcaagattctgtt
aaaacatatgccctagaatctataaataatgttgtggaccaattatggtctgagatctcg
aatgaactgccggatattgaggcattgtatgatgacgataccttttcagaccgtgaaatg
gctgctttgattgcatccaaagtttattacaatcttggtgaatacgaatcggctgtgaag
tatgcacttgccgcaaaggatcgttttgatatagacgaaaagtcacaatttgttgaaact
atagtctcaaagagtattgagatgtacgtccaagaggcttccaagcaatacactaaggac
gaacaattttacaccaaggatattattgacccaaaattaacctctatttttgagcgaatg
atagaaaaatgtttgaaagcttcagaattaaaattagctttaggaattgccttagaaggt
tacagattggatatcattgaaagtgctttaaagagcaaattggatcaggattccacttct
gaaaacgttaaaattattaactacttattgaccttagctataactactgtgacaaattcc
aagttcagatcctcgatattgagaaaatcatttgatttcctaatgaatatgcctaactgc
gattacttaacgctcaataaagtagttgtaaatttgaatgacgccggattggcacttcag
ctatttaaaaaattaaaggaagagaacgatgaaggattatctgctcaaattgcatttgat
ttggtttcgtctgcgtctcagcagttgcttgagattttagtaaccgaactaactgcccag
ggttacgatcctgccttattgaatattctatctgggctaccgacttgtgattattacaat
accttccttttgaataataaaaacattgacatcggtcttttaaacaagtctaaatcatct
ttggatgggaaattttctttgttccacaccgcagtcagcgttgccaacggttttatgcac
gctggtactaccgacaattcatttatcaaggcgaacttgccatggttaggtaaggctcaa
aattgggctaaatttacagctacagcctctttaggtgtaattcataaaggcaatttattg
gagggtaaaaaagtcatggccccttacttgccaggcagtcgagcttcttctaggtttatc
aaaggtggttcattgtatggtttgggtttaatttatgctggctttggtcgtgatacaact
gactatctgaaaaacataatagttgagaatagcggaacttcaggcgatgaagacgtagat
gtattgttacatggtgcttcactgggtatcggtcttgctgctatgggttctgctaatatt
gaagtttatgaagccttaaaggaagttctgtacaacgattctgccacatctggagaagca
gctgcattaggtatgggtctctgtatgctcggaacaggtaagcctgaagcgattcacgat
atgtttacatattcccaagaaacgcagcatggcaatattactcgtggtctagccgttggt
ttagcactgataaattacggccgtcaagagttagctgatgatttaattactaagatgtta
gcaagtgatgagtccttgttacgctatggaggtgcattcacaatcgcgttagcgtatgcg
ggtacgggaaataattcagctgtcaagagattactgcatgtggcagtctcggattctaac
gatgatgtcagaagggcagcagtcatcgcattagggtttgttctcttgcgtgattatacc
actgtaccaaggattgtccaacttctatctaaatcgcataacgctcatgtcagatgtggt
accgcatttgctcttgggattgcttgtgccggcaagggtttacaatcagctattgacgtt
ttagatccgctaacaaaggacccagtagattttgttcgtcaggctgccatgatagcttta
tccatgattttgattcaacaaacagaaaaactaaaccctcaagttgctgatattaacaaa
aattttttgagcgtgattacaaacaaacaccaagaaggtttagccaaattcggtgcatgt
gtggcccaaggtataatgaatgccggtgggcgtaatgttacaattcagctggaaaatgcg
gatacaggcacattggataccaagtccgtagttggtttggtcatgttctcacaattctgg
tactggttcccactggctcactttttatccctttcttttacaccaacaactgtcattggt
attcgtggtagcgatcaagctatacccaaatttcaaatgaattgttacgctaaagaagat
gcattcagttatccgaggatgtatgaggaagcaagtggtaaggaggtagagaaggtagca
acagctgttctttccacgacagcaagagcaaaagcaagggcaaagaagacaaagaaggaa
aagggtccaaatgaggaagaaaagaaaaaagagcatgaggaaaaagaaaaggaaagagag
acgaataaaaaaggcataaaagaaacaaaagaaaacgacgaagaattttacaaaaataag
tactcttctaaaccttataaagtcgacaatatgacccgtatactaccacaacaatcgaga
tatatttcctttattaaggacgacagatttgttcctgtacgtaaattcaaaggaaataac
ggtgtggtggttttaagagatagggaacccaaggaacctgtagcactaattgaaactgtt
aggcaaatgaaagatgttaacgctccacttccaaccccatttaaggtcgatgataatgtc
gacttccctagtgcttag

DBGET integrated database retrieval system