KEGG   Saccharomyces cerevisiae (budding yeast): YJL155CHelp
Entry
YJL155C           CDS       T00005                                 

Gene name
FBP26
Definition
(RefSeq) fructose-2,6-bisphosphatase
  KO
K19029  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 2 [EC:2.7.1.105 3.1.3.46]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    YJL155C (FBP26)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     YJL155C (FBP26)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     YJL155C (FBP26)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 Roc DUF3768 AAA_14
Motif
Other DBs
NCBI-GeneID: 853286
NCBI-ProteinID: NP_012380
SGD: S000003691
UniProt: P32604
Position
X:complement(129285..130643)
Genome map
AA seq 452 aa AA seqDB search
MGYSTISNDNDIKVCVIMVGLPARGKSFISQKIIRYLSWLSIKAKCFNVGNYRRDVSGNV
PMDAEFFNFENTDNFKLRELAAQNAIKDIVNFFTKEDGSVAVFDATNSTRKRRKWLKDIC
EKNNIQPMFLESWSNDHELIINNAKDIGSTSPDYENSEPHVAEADFLERIRQYERFYEPL
DPQKDKDMTFIKLVNIIEEVVINKIRTYLESRIVFYVMNIRPKPKYIWLSRHGESIYNVE
KKIGGDSSLSERGFQYAKKLEQLVKESAGEINLTVWTSTLKRTQQTANYLPYKKLQWKAL
DELDAGVCDGMTYEEIEKEYPEDFKARDNDKYEYRYRGGESYRDVVIRLEPVIMELERQE
NVLIITHQAVLRCIYAYFMNVPQEESPWMSIPLHTLIKLEPRAYGTKVTKIKANIPAVST
YKEKGTSQVGELSQSSTKLHQLLNDSPLEDKF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggggtacagtactatttccaacgataatgatatcaaagtatgtgtgataatggttggc
ctaccagctagaggaaagtcttttatttcccaaaaaattatcaggtacttatcgtggtta
tccataaaagccaagtgttttaatgtgggaaattacagaagagacgtgagtggaaatgtc
ccaatggatgctgagttttttaacttcgaaaatacagataattttaaactcagagaattg
gctgcccaaaatgccataaaagatattgttaatttttttactaaagaagacggatctgtg
gcagttttcgatgctactaatagtacacgtaaaagaaggaaatggcttaaagatatatgt
gaaaagaataatattcaaccgatgtttttagagagctggagtaacgatcatgaactgatt
ataaataacgctaaggatatcggtagcacatctcctgattatgaaaactctgaacctcat
gtggcggaagctgattttttggaaagaattagacaatatgaaagattttatgaacctttg
gacccccaaaaagataaggatatgacgttcattaagttggtcaatattattgaagaagta
gtaattaataagatcagaacatatttggaaagtaggattgtattttatgttatgaatatt
cgtcctaaaccaaaatatatctggctctcccgtcacggcgaatcgatctataacgtagag
aaaaaaattggcggggattcatcactgtctgaaagaggctttcagtacgctaaaaaattg
gagcagttagtgaaagagagcgcaggagaaataaatttgaccgtgtggacttccacctta
aaaagaacacaacaaacggcaaattatcttccctataagaaactgcaatggaaagcactt
gatgaattagacgctggcgtttgtgacggaatgacgtatgaggaaattgaaaaagaatat
cctgaagattttaaagcacgtgataatgacaaatacgagtacagatatcgtggtggagaa
tcatacagagatgtagtgattcgtttagagcccgtcattatggaattggagcgccaagaa
aatgttctcattataactcatcaagccgtacttcggtgtatatatgcatattttatgaac
gttccacaggaggaatccccttggatgtcaatcccactacacacattgatcaagctggag
cctagggcctatggcacaaaggtcaccaaaattaaagcaaacatccctgcagtgagtaca
tataaagagaagggtacaagccaagtaggtgagctttctcaaagctcaactaaacttcat
caactgctcaatgactctcctttggaagacaaattttaa

DBGET integrated database retrieval system