KEGG   Saccharomyces cerevisiae (budding yeast): YLR167W
Entry
YLR167W           CDS       T00005                                 

Gene name
RPS31, RPS37, UBI3
Definition
(RefSeq) ubiquitin-ribosomal 40S subunit protein S31 fusion protein
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YLR167W (RPS31)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YLR167W (RPS31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YLR167W (RPS31)
   04121 Ubiquitin system [BR:sce04121]
    YLR167W (RPS31)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YLR167W (RPS31)
Ribosome [BR:sce03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    YLR167W (RPS31)
  Archaea
    YLR167W (RPS31)
Ubiquitin system [BR:sce04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   YLR167W (RPS31)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YLR167W (RPS31)
  Exosomal proteins of colorectal cancer cells
   YLR167W (RPS31)
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 DUF2407 IBR Fer2_3
Other DBs
NCBI-GeneID: 850864
NCBI-ProteinID: NP_013268
SGD: S000004157
UniProt: P05759
Structure
PDB: 

Position
XII:498947..499405
AA seq 152 aa
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHKKVKLAVLSYYKVDAEGKVTKLRRE
CSNPTCGAGVFLANHKDRLYCGKCHSVYKVNA
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcaaattttcgtcaagactttaaccggtaagactattaccctggaagttgaatcttct
gacactattgacaatgtcaagtccaagatccaagacaaggaaggtattccacctgaccaa
caaagattgatctttgctggtaagcaattggaagatggtagaactttgtccgactacaac
atccaaaaggaatctactctacacttggtcttgagattgagaggtggtggtaagaagaga
aagaagaaggtctacaccaccccaaagaagatcaagcacaagcacaagaaggtcaagttg
gctgtcttgtcctactacaaggtcgatgctgaaggtaaggttaccaaattgagaagagaa
tgtagcaacccaacttgtggtgctggtgttttcttggctaaccacaaggacagattgtac
tgtggtaagtgtcattccgtctacaaggttaacgcttaa

DBGET integrated database retrieval system