KEGG   Saccharomyces cerevisiae (budding yeast): YLR348C
Entry
YLR348C           CDS       T00005                                 

Gene name
DIC1
Definition
(RefSeq) Dic1p
  KO
K13577  solute carrier family 25 (mitochondrial dicarboxylate transporter), member 10
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YLR348C (DIC1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YLR348C (DIC1)
SSDB
Motif
Pfam: Mito_carr SLC25_like
Other DBs
NCBI-GeneID: 851063
NCBI-ProteinID: NP_013452
SGD: S000004340
UniProt: Q06143
Position
XII:complement(826977..827873)
AA seq 298 aa
MSTNAKESAGKNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILA
NEGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGG
LAGNFADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGIL
MTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSG
DHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKHRVGMPKEDK
NT seq 897 nt   +upstreamnt  +downstreamnt
atgtcaaccaacgcaaaagagtctgccggtaagaatatcaagtatccatggtggtacgga
ggtgcagcgggtatctttgctaccatggtgacacatcctcttgacttggccaaagtcaga
ctgcaggcggctcctatgcccaagcccacactcttcaggatgttggagagtatcttggcg
aatgaaggtgtggtggggttatattccggcctgagcgctgctgtgttgaggcaatgtaca
tacacgacggtgagattcggtgcatacgacttgttgaaagagaatgtgatcccacgcgag
caattgactaacatggcgtatcttttaccttgctccatgttcagtggtgccattgggggg
cttgcagggaattttgcagatgttgtaaatatcagaatgcaaaacgactctgctttggag
gcagcgaagaggagaaactacaaaaacgctatcgatggtgtgtacaagatatatcgctac
gagggtggactgaaaaccttgtttaccggttggaagcctaacatggttaggggcatactg
atgacggcaagtcaggtcgttacgtatgacgtgtttaagaactacttggtcacaaaatta
gatttcgacgcatccaagaactatacacacttgacagcgtccctgttggctggcctggtg
gccaccactgtgtgctctccagcagacgtcatgaagacacgtatcatgaacggcagcgga
gaccatcaaccggctttgaagatccttgccgacgctgtccgcaaagagggcccatctttc
atgttccgggggtggttgccaagtttcactagactgggtccattcacaatgttaattttc
tttgcaattgagcaattgaaaaaacatagggttggcatgccaaaggaagacaagtag

DBGET integrated database retrieval system