KEGG   Saccharomyces cerevisiae (budding yeast): YLR425W
Entry
YLR425W           CDS       T00005                                 
Symbol
TUS1, SOP10
Name
(RefSeq) Rho family guanine nucleotide exchange factor TUS1
  KO
K19843  Rho1 guanine nucleotide exchange factor TUS1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YLR425W (TUS1)
SSDB
Motif
Pfam: RhoGEF PH_5 PH PH_12 DAAD Ezh2_MCSS Remorin_C
Other DBs
NCBI-GeneID: 851145
NCBI-ProteinID: NP_013529
SGD: S000004417
UniProt: Q06412
Position
XII:982894..986817
AA seq 1307 aa
MYRYNRSSPFERTPEKRVSRQESQRKSIELPKLPPLNTRNSFLDDSDNGTDNISIGWTPI
SDTQQFQSPVPQAFTFTSKHSARGNGTSSSESTPKSTKYVKERRPPPPPPLLYSTESIRI
DSPMVSPSSQSRERSPNKLSFIGNSEERHHMEYISNHSRILKSPFANGFSPNSPKSPRDS
SKQQAHFSDESDLRCHEREKALPPIPFTTTLLLSPFDDEDSEFFTKPPPPLSTSRNVSGN
SRVSEALESVYSDSDYTFNNSNARQSSFNSLLGAKPLELAPSITAPTQPFSIQSIDEHKL
YQCDNVYKLSAIYEWILKVYFEWFNECVFTKIDLFQIVQLLLEFQMPTNFDQDTIDSNVD
NIMASFISQKAVRFDIINDEEVAVVVGGLDITGVFTELLPCYSFIDNTYGSTNSLICYSN
VCTHGQSSGFRKEIKLSEIINKSVGLWTEYWHLTPDDLAEINPREVQRQSFIFDLIILEE
RSLNMATAAVEIYGKRFDKSLLPDEPEFKALAFDIFEPLIQLHTEFLLTPIFWKLKTRGK
FIDGVGKIYSKWCGEAKNIYLNYAKAMATVHEIIMWEKKNKTKFVTWLKEIDNSVEITRS
KMYHDVIFFGGFFKSLQNMPVTLRSILKNTDPSMEDYEYLKIVIKEVEKLNFEVNQVHGL
AIDHRKLVRFSKQLVLSTNSSNATSYVNVGGSTNANDDDAIQDKLALGLTYPERKLVLSG
TVYKKRDLWLDPTPVYIALLDNCLLITEEISKGETQKYKLIERPIPIDYLSLEKRKIPGT
SKQPLRNYSQKEHKSPMHNFSTPINSMRPLLKSSGNHMSTAYGDRKTSNTEISNANPNTD
EFSFKIRNTATGESFKFFTESAEVLNQWIDAIMESFKRNAENHDLNAFEFTVLSSEFAYF
DKDAPVNLPVAPEGSEIDVALKAYAQKANKDSCSWSKTTRILCCEDVKFEGRIYLFVATT
DGIYVKYRDDYGSGFVKILELNDVKRMEANVKLGLLFVLDNRKLCYFNISTVVSRYLAQG
NTLDENCIVGTVIRDKVRFFKIADDFGNSKHLFFERKGKIVILTPEFDQLTNQVKYFKFY
KEYKLPSSSNNILNNEIEDIAIFRKSFAVCTKKTVILYQDSFEDNGIVLPSFLNDKDMMA
HLRHPHLNSLPFKSATDSKKRPSIESLTEEAKKDIATCKAIPVNFFQISQSSFFALVYDE
AVVKINCYGEMSDWRKDILLLDFCCTGASFHGNHLILVGDNLIQIYDLKNVEQNLGELVP
VQIIKGKKIKLASSERREKTILVLSHPNILNRQLLVACNPVAMADHQ
NT seq 3924 nt   +upstreamnt  +downstreamnt
atgtatcgatataatagaagttccccttttgaacgaacaccagaaaaacgagtaagccgt
caagaaagccaacgaaagagcatcgaattgcccaaactgccaccattgaatacgaggaac
tcctttttggatgattctgataacggaacagataatatctcaattggctggacaccaatc
agtgacacccagcaattccaaagcccggtccctcaggcttttacctttacatcaaaacat
agtgcaaggggaaacggtactagctcttcagaatccacacccaaatcgacaaagtacgtc
aaagaaagacgaccaccaccaccgccaccccttttgtattccactgaatcaatacggata
gactcacccatggtatctcccagttctcagtcccgggaaagatcacctaataaactatcc
tttataggaaactcagaggaacgacatcacatggaatacatatctaaccattccaggatc
ttaaaatcaccatttgcgaacggatttagtccaaattcccctaaatctccaagagatagt
agcaaacagcaggctcacttctctgatgaatcagatctacggtgtcatgaaagagaaaaa
gctttacccccaattcctttcactactactcttctgctatctccttttgatgatgaagac
tcagaattttttacgaaaccaccaccgcctctatcaacatctagaaacgtaagtgggaat
agccgagtatcagaagccctagaaagtgtttattctgactcagattatacttttaataac
tcaaatgccaggcaaagtagttttaactctttactaggagccaagccattagaattagca
ccaagcattactgcaccgacacaaccattttcaattcaatctatcgatgagcacaagctt
tatcaatgtgataatgtttacaaactttctgctatttatgagtggattttgaaagtttat
tttgaatggtttaatgaatgtgtcttcacgaaaatcgatcttttccaaattgttcaatta
cttttagagtttcaaatgcctacaaatttcgatcaagatacgatagactcaaatgtggat
aatattatggcttcgtttatttcccagaaagcagtaagattcgatatcattaacgatgaa
gaggtagccgtagttgtgggagggctggatattactggtgttttcaccgaactactaccg
tgctattcattcatcgataatacttatggatctacaaactccctgatttgttattccaac
gtttgcacacatggccaaagctctggcttcagaaaagaaataaaactttccgaaatcata
aataaatcagttggactttggacagaatactggcacttgactccagatgatttagcagaa
attaatccccgtgaagtacaaagacaaagctttatatttgacttaattattttagaagaa
agatccttaaacatggctactgccgcggtagaaatctatgggaaacggtttgacaaatcc
ctacttccagatgagcctgagttcaaggcattggcatttgatatcttcgaacctctaata
caattacataccgaatttcttttgacgccaatattttggaaattaaaaacgagaggtaag
tttattgatggcgttggaaaaatctattcaaaatggtgtggtgaagccaagaatatatat
ttgaattacgcgaaagctatggcaacggtacacgaaatcataatgtgggagaagaaaaac
aagacgaaatttgtaacatggcttaaggagattgataactcggttgaaattacaagatcg
aagatgtatcatgatgttatattctttggggggtttttcaaatctttacaaaacatgccc
gtaactctgcgctcaattttgaagaacacggatccttccatggaggattatgaatacctg
aaaatagtaattaaggaagtagaaaagttgaactttgaagttaatcaggtacatggatta
gcaattgaccataggaaactagtaaggttttcgaaacaattagtattaagtactaatagt
agtaatgcaacaagctatgtgaacgtcggtggtagtactaacgcaaatgacgatgatgca
attcaggataaactagctcttggtttaacttatccggaaaggaagttagtactatctggc
actgtttataaaaagagggatttatggctggacccaaccccagtgtatatcgcattattg
gacaattgcttactgattacagaggaaataagtaaaggagaaactcaaaaatataagctt
attgaaagacctatcccaatagattatttaagtctcgagaaaaggaaaattccaggaaca
agtaaacagcctctgagaaactactctcagaaagaacataaatccccaatgcataatttt
tcgacaccgattaactccatgagacctctgcttaaaagttctggaaatcacatgtcaaca
gcgtatggagatagaaagactagtaatactgaaatttctaacgcgaatccaaacacagac
gagttctcatttaagatcagaaatacagccacaggtgaatcgttcaaattttttacagaa
agtgcagaagtactcaaccaatggattgatgctatcatggaatcttttaaaagaaatgca
gaaaatcatgatttaaatgcctttgaatttacagtgttgagctctgagttcgcatacttc
gacaaggatgcaccggtgaatctacctgtagctccggaaggatcagaaattgatgtagca
ctcaaagcttacgctcaaaaagcaaacaaagattcatgttcatggagtaagacaacacgg
attctttgttgtgaagatgttaaattcgagggcagaatttacctatttgtggctacaaca
gacggtatctatgtgaaatatagagacgattatggtagtggtttcgttaaaatattagaa
ttaaacgacgtcaaaagaatggaagccaatgttaagttggggctcttgtttgtattggat
aacagaaagttgtgctattttaatatctcaacggtagtgagccgttacctagcgcaagga
aacactctagatgaaaactgcattgtgggaacagtaatcagagataaggtgagattcttc
aaaattgctgatgattttggtaactcaaaacatttattttttgaaagaaaggggaagata
gttatattaacaccagaatttgatcaattgacaaaccaagtaaaatatttcaaattttac
aaagagtataagctcccaagttcaagtaataacattctgaataacgaaattgaggatatt
gccatattcaggaaaagttttgctgtgtgtacaaagaaaacagtcatactttatcaagat
tcattcgaggataacggaatagtcttaccatcttttttgaatgataaagatatgatggca
cacttgaggcatccacatttgaatagcttaccgttcaaaagtgctacagactccaagaaa
cgcccctccatagaatctctcactgaagaagcaaaaaaggatatcgccacttgcaaagct
ataccggtcaatttttttcaaatatcacaatctagtttttttgccttggtttatgatgaa
gccgtagtgaaaataaactgctacggtgagatgtctgattggagaaaggatattctctta
cttgatttttgttgtaccggcgcgagcttccatggtaatcatttgattctcgttggcgac
aatttgatacagatttacgacttaaaaaatgttgagcagaacctaggcgaattggttccc
gtccagatcataaaaggaaagaagataaagctggctagttcagaaaggagagagaaaaca
attcttgtgttaagtcatccaaatatacttaatagacaattattagtcgcgtgcaatcct
gtagcaatggcagatcatcaataa

DBGET integrated database retrieval system