KEGG   Saccharomyces cerevisiae (budding yeast): YMR074CHelp
Entry
YMR074C           CDS       T00005                                 

Gene name
SDD2
Definition
(RefSeq) Sdd2p
  KO
K06875  programmed cell death protein 5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    YMR074C (SDD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dsDNA_bind EF-1_beta_acid
Motif
Other DBs
NCBI-GeneID: 855096
NCBI-ProteinID: NP_013790
SGD: S000004678
UniProt: Q04773
Structure
PDB: 

Position
XIII:complement(413036..413473)
Genome map
AA seq 145 aa AA seqDB search
MDPELQAIREARLAQLKNNSGGTNGDRNSGANNGGGENSAPVGAAIANFLEPQALERLSR
VALVRRDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFERKDF
SEDLNSFDKQNAKNDDDEDDDDFFD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggacccagagttacaagctattagggaagccagattggctcagttgaaaaacaacagt
gggggtaccaacggcgatagaaatagcggtgctaataatggtggaggtgaaaattccgct
cccgttggtgcagctattgcaaatttcttggagccacaagctttagaaagattatctcga
gtggccttggtccgtagagacagggcccaagcagtagagacatacttaaagaaactgatt
gctacaaacaacgtcactcataaaatcactgaagctgaaattgtttcaatcttgaatggt
atcgccaagcaacaaaattcacaaaataacagtaagattatcttcgaacggaaagatttc
agcgaagatctgaattcatttgacaagcagaatgctaaaaatgatgacgacgaagatgat
gacgacttctttgattag

DBGET integrated database retrieval system