KEGG   Saccharomyces cerevisiae (budding yeast): YMR080C
Entry
YMR080C           CDS       T00005                                 

Gene name
NAM7, IFS2, MOF4, SUP113, SUT2, UPF1
Definition
(RefSeq) ATP-dependent RNA helicase NAM7
  KO
K14326  regulator of nonsense transcripts 1 [EC:3.6.4.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YMR080C (NAM7)
   03015 mRNA surveillance pathway
    YMR080C (NAM7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YMR080C (NAM7)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     YMR080C (NAM7)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     YMR080C (NAM7)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YMR080C (NAM7)
SSDB
Motif
Pfam: UPF1_Zn_bind AAA_12 AAA_11 DUF5599 AAA_30 AAA_19 Viral_helicase1 DUF2075 ResIII Helicase_RecD PIF1 PhoH HEM4 DEAD AAA_22 T2SSE
Other DBs
NCBI-GeneID: 855104
NCBI-ProteinID: NP_013797
SGD: S000004685
UniProt: P30771
Structure
PDB: 
2XZL

Position
XIII:complement(426712..429627)
AA seq 971 aa
MVGSGSHTPYDISNSPSDVNVQPATQLNSTLVEDDDVDNQLFEEAQVTETGFRSPSASDN
SCAYCGIDSAKCVIKCNSCKKWFCNTKNGTSSSHIVNHLVLSHHNVVSLHPDSDLGDTVL
ECYNCGRKNVFLLGFVSAKSEAVVVLLCRIPCAQTKNANWDTDQWQPLIEDRQLLSWVAE
QPTEEEKLKARLITPSQISKLEAKWRSNKDATINDIDAPEEQEAIPPLLLRYQDAYEYQR
SYGPLIKLEADYDKQLKESQALEHISVSWSLALNNRHLASFTLSTFESNELKVAIGDEMI
LWYSGMQHPDWEGRGYIVRLPNSFQDTFTLELKPSKTPPPTHLTTGFTAEFIWKGTSYDR
MQDALKKFAIDKKSISGYLYYKILGHQVVDISFDVPLPKEFSIPNFAQLNSSQSNAVSHV
LQRPLSLIQGPPGTGKTVTSATIVYHLSKIHKDRILVCAPSNVAVDHLAAKLRDLGLKVV
RLTAKSREDVESSVSNLALHNLVGRGAKGELKNLLKLKDEVGELSASDTKRFVKLVRKTE
AEILNKADVVCCTCVGAGDKRLDTKFRTVLIDESTQASEPECLIPIVKGAKQVILVGDHQ
QLGPVILERKAADAGLKQSLFERLISLGHVPIRLEVQYRMNPYLSEFPSNMFYEGSLQNG
VTIEQRTVPNSKFPWPIRGIPMMFWANYGREEISANGTSFLNRIEAMNCERIITKLFRDG
VKPEQIGVITPYEGQRAYILQYMQMNGSLDKDLYIKVEVASVDAFQGREKDYIILSCVRA
NEQQAIGFLRDPRRLNVGLTRAKYGLVILGNPRSLARNTLWNHLLIHFREKGCLVEGTLD
NLQLCTVQLVRPQPRKTERPMNAQFNVESEMGDFPKFQDFDAQSMVSFSGQIGDFGNAFV
DNTELSSYINNEYWNFENFKSAFSQKQNRNEIDDRNLYQEEASHLNSNFARELQREEQKH
ELSKDFSNLGI
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggtcggttccggttctcacactccttatgatatatcaaactctccatctgatgtaaat
gtccaacccgcaacacaactaaattccaccttggtggaggatgacgatgtagataatcag
ctatttgaagaggctcaagtcactgagactggattccgttcgccttcagcttcagacaat
tcatgtgcgtattgtggtatagattctgcaaagtgtgtcatcaaatgtaattcatgtaag
aaatggttttgtaacactaaaaacggtacaagcagctcccacattgttaatcacttagtt
ttatcccaccataacgtagtttctttacatccagattctgacttaggggataccgttttg
gaatgttataactgtggacgtaagaacgtgtttttattgggatttgtttccgctaaaagt
gaggccgtggttgttttactttgtagaataccttgtgcccagacgaaaaatgcgaactgg
gatactgatcaatggcaaccattaattgaagacagacaacttttatcatgggtcgcagag
caaccaactgaagaagaaaaattgaaagctcgtttaatcactcctagccaaatttccaag
ttggaggcaaaatggagatccaataaagacgctacaattaatgatattgacgccccagag
gaacaggaagcaatcccacctttactattgagatatcaagacgcctacgaataccaaaga
tcttacgggcctttaatcaaattggaggccgactatgataaacaactcaaggaatctcaa
gctttagaacatatttctgtttcatggtccttagctttaaataataggcatttagcatct
ttcactttatctactttcgaatctaacgagttgaaagttgccatcggtgatgaaatgata
ctatggtactctggcatgcaacatcctgattgggaaggtcgtggttacattgttcggtta
ccaaatagcttccaggacacattcacattagagttaaaaccaagtaaaacgccacctcca
acacatttgaccactggttttactgctgagttcatctggaaaggtacctcttatgacagg
atgcaagacgcattgaaaaaatttgccattgataaaaaatctatttcaggttatttgtac
tataaaattttaggccatcaagtggttgacatttcatttgatgtcccattacctaaggag
ttttcaattccgaattttgcacaattaaactcatcccagtcgaacgctgttagtcatgta
ttacaacgtccgttatctttaattcaaggcccaccaggcactggtaaaacagttacttca
gcaacgattgtgtatcacctttccaaaatacacaaggatagaatattggtgtgtgcccca
tcaaacgttgctgtagatcatttggctgccaaattacgtgacttgggtttaaaagttgtt
agacttaccgcgaaaagtagagaagatgtggagagttccgtctccaacttagcattgcat
aatttggttggccgtggtgctaaaggggaattaaaaaacctattaaagttaaaggatgaa
gttggcgaattatctgcttctgatacaaaacggtttgttaaattagtaaggaaaacagaa
gcagaaattctcaataaggcagatgtcgtatgttgcacatgtgttggtgctggtgataag
cgcttagacactaaatttaggactgtgttaattgatgaaagtactcaagcttctgagccg
gaatgtttaatcccaatcgttaaaggtgcgaaacaagttatacttgttggtgatcaccag
caactgggcccagtcatattggaacgaaaggcggcagacgctggtttgaaacaatctctc
tttgaaagattaatctctctaggccacgtaccgattcgtttggaagttcaataccgtatg
aatccttatttgagtgagtttccaagtaacatgttttatgaaggcagcctacaaaatggt
gtaacgattgaacagcgtaccgttcccaacagcaaattcccatggccaattcgcggtata
ccaatgatgttttgggccaattacggtagagaggagatttctgctaacggtacttccttc
ttaaacagaattgaagccatgaattgtgaacgaatcatcactaaacttttcagagacggt
gtcaagcccgagcaaattggtgttatcacaccatatgagggacaaagagcttatatttta
caatatatgcaaatgaatggttcattggataaggatttgtatatcaaagtggaagttgcc
tcagttgatgcattccaaggtcgtgaaaaggattacataatcttatcgtgtgttcgtgcc
aatgaacaacaggccattggtttcttacgtgatcctcgtcgtctaaacgtgggtctaacc
cgtgccaaatatggtctagttattcttggtaatcctagatctttggcaagaaacacatta
tggaaccatctgttaatccacttcagagagaagggttgtttagtcgaaggtacgttggat
aacttacagttatgcactgttcaattagttcgtcctcagccaagaaagactgaacggcca
atgaacgctcaatttaacgtagaatctgaaatgggtgactttccgaagttccaggatttt
gatgcacagagtatggtgtcattcagtggtcaaattggggactttggtaatgcatttgtt
gacaacacagaactttcttcttacatcaataatgaatattggaattttgagaattttaaa
agtgctttttctcaaaagcaaaatcgcaatgaaattgacgatagaaatttgtaccaggag
gaggcttctcatttgaactctaacttcgcgagagagttacagagagaagaacaaaagcat
gaattgtcaaaagacttcagcaatttgggaatataa

DBGET integrated database retrieval system