KEGG   Saccharomyces cerevisiae (budding yeast): YNL003C
Entry
YNL003C           CDS       T00005                                 

Gene name
PET8, SAM5
Definition
(RefSeq) Pet8p
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YNL003C (PET8)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YNL003C (PET8)
SSDB
Motif
Pfam: Mito_carr SLC25_like
Other DBs
NCBI-GeneID: 855729
NCBI-ProteinID: NP_014395
SGD: S000004948
UniProt: P38921
Position
XIV:complement(624975..625829)
AA seq 284 aa
MNTFFLSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANGGYKGIYRGLGSAVVASAP
GASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEVVKQ
RTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYLKKTWA
KANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTASLGSVIIRIYREEGP
AVFFSGVGPRTMWISAGGAIFLGMYETVHSLLSKSFPTAGEMRA
NT seq 855 nt   +upstreamnt  +downstreamnt
atgaatactttttttctttccttgctaagtggcgccgctgctggtacctctacggatttg
gtttttttccctatagacacaattaaaaccaggcttcaagctaagggtggattctttgct
aatggaggatacaaaggcatatatcgtggtttgggaagcgctgttgtagcatcggcgcca
ggtgcttcacttttctttattagttatgattatatgaaagtaaaatcaaggccatatatc
agcaaactttactcacagggatctgagcaattgattgatacgacaacgcacatgctttcc
tcttccattggtgaaatttgtgcttgtcttgttcgagttcccgcagaagtcgttaagcaa
aggacgcaagttcactctaccaattcttcctggcagactttacagtcaattctacgaaat
gacaataaggaaggtttaaggaaaaatctttatagagggtggtctaccaccattatgaga
gaaataccgtttacttgtatacagtttcctttatacgagtatctaaaaaagacttgggca
aaagccaatggccaaagtcaagtggagccatggaaaggggctatctgcggttctattgcg
ggtgggatcgcagcagctacaacgacaccattagatttcttgaaaaccagattaatgctc
aacaaaacaaccgcctcacttggaagcgttattattaggatttacagagaggaaggtcct
gctgtatttttcagtggagtggggccccggacaatgtggatcagtgcaggtggtgctatc
ttcctaggcatgtatgaaactgttcattcgttattatcgaaaagtttcccaacggctgga
gaaatgagagcgtaa

DBGET integrated database retrieval system