KEGG   Saccharomyces cerevisiae (budding yeast): YNL219CHelp
Entry
YNL219C           CDS       T00005                                 

Gene name
ALG9
Definition
(RefSeq) dolichyl-P-Man:Man(6)GlcNAc(2)-PP-dolichol alpha-1,2-mannosyltransferase
  KO
K03846  alpha-1,2-mannosyltransferase [EC:2.4.1.259 2.4.1.261]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00510  N-Glycan biosynthesis
sce00513  Various types of N-glycan biosynthesis
sce01100  Metabolic pathways
Module
sce_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    YNL219C (ALG9)
   00513 Various types of N-glycan biosynthesis
    YNL219C (ALG9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YNL219C (ALG9)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.259  dolichyl-P-Man:Man6GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase
     YNL219C (ALG9)
    2.4.1.261  dolichyl-P-Man:Man8GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase
     YNL219C (ALG9)
Glycosyltransferases [BR:sce01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   YNL219C (ALG9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_22
Motif
Other DBs
NCBI-GeneID: 855502
NCBI-ProteinID: NP_014180
SGD: S000005163
UniProt: P53868
Position
XIV:complement(235996..237663)
Genome map
AA seq 555 aa AA seqDB search
MNCKAVTISLLLLLFLTRVYIQPTFSLISDCDETFNYWEPLNLLVRGFGKQTWEYSPEYS
IRSWAFLLPFYCILYPVNKFTDLESHWNFFITRACLGFFSFIMEFKLHREIAGSLALQIA
NIWIIFQLFNPGWFHASVELLPSAVAMLLYVGATRHSLRYLSTGSTSNFTKSLAYNFLAS
ILGWPFVLILSLPLCLHYLFNHRIISTIRTAFDCCLIFSLTAFAVIVTDSIFYGKLAPVS
WNILFYNVINASEESGPNIFGVEPWYYYPLNLLLNFPLPVLVLAILGIFHLRLWPLWASL
FTWIAVFTQQPHKEERFLYPIYGLITLSASIAFYKVLNLFNRKPILKKGIKLSVLLIVAG
QAMSRIVALVNNYTAPIAVYEQFSSLNQGGVKAPVVNVCTGREWYHFPSSFLLPDNHRLK
FVKSGFDGLLPGDFPESGSIFKKIRTLPKGMNNKNIYDTGKEWPITRCDYFIDIVAPINL
TKDVFNPLHLMDNWNKLACAAFIDGENSKILGRAFYVPEPINRIMQIVLPKQWNQVYGVR
YIDYCLFEKPTETTN
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaattgcaaggcggtaaccattagtttattactgttgttatttttaacaagagtatat
attcagccgacattctcgttaatttcagattgcgatgaaacttttaattattgggaacca
ttaaatttattggtacgtggatttggtaaacaaacctgggaatattcacccgagtattct
attagatcatgggctttcttattacctttttactgtattctttatccagtaaacaaattt
actgacctagaaagtcattggaactttttcatcacaagagcatgcttaggcttttttagt
tttatcatggaatttaaactacatcgtgaaattgcaggcagcttggcattgcaaatcgca
aatatttggattattttccaattgtttaatccgggctggttccatgcatctgtggaatta
ttgccttctgccgttgccatgttgttgtatgtaggtgccaccagacactctctacgctat
ctgtccactgggtctacttctaactttacgaaaagtttagcgtacaatttcctggctagt
atactaggctggccatttgttttaattttaagcttgccattatgtttacattaccttttc
aaccatagaattatttctaccatcagaaccgcattcgactgctgtttgatattttcattg
actgcatttgctgtgattgtcactgacagtatattttacgggaagcttgctcctgtatca
tggaacatcttattttacaatgtcattaatgcaagtgaggaatctggcccaaatattttc
ggggttgagccatggtactactatccactaaatttgttactgaatttcccactgcctgtg
ctagttttagctattttgggaattttccatttgagattatggccattatgggcatcatta
ttcacatggattgccgttttcactcaacaacctcacaaagaggaaagatttctctatcca
atttacgggttaataactttgagtgcaagtatcgccttttacaaagtgttgaatctattc
aatagaaagccgattcttaaaaaaggtataaagttgtcagttttattaattgttgcaggc
caggcaatgtcacggatagtggctttggtgaacaattacacagctcctatagccgtctac
gagcaattttcttcactaaatcaaggtggtgtgaaggcaccggtagtgaatgtatgtacg
ggacgtgaatggtatcacttcccaagttctttcctgctgccagataatcataggctaaaa
tttgttaaatctggatttgatggtcttcttccaggtgattttccagagagtggttctatt
ttcaaaaagattagaactttacctaagggaatgaataacaagaatatatatgataccggt
aaagagtggccgatcactagatgtgattattttattgacatcgtcgccccaataaattta
acaaaagacgttttcaaccctctacatctgatggataactggaataagctggcatgtgct
gcattcatcgacggtgaaaattctaagattttgggtagagcattttacgtaccggagcca
atcaaccgaatcatgcaaatagttttaccaaaacaatggaatcaagtgtacggtgttcgt
tacattgattactgtttgtttgaaaaaccaactgagactactaattga

DBGET integrated database retrieval system