KEGG   Saccharomyces cerevisiae (budding yeast): YOL109WHelp
Entry
YOL109W           CDS       T00005                                 

Gene name
ZEO1
Definition
(RefSeq) Zeo1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Apolipoprotein ApoLp-III IFT57 Exonuc_VII_L Baculo_PEP_C Spc7
Motif
Other DBs
NCBI-GeneID: 854040
NCBI-ProteinID: NP_014532
SGD: S000005469
UniProt: Q08245
Position
XV:110297..110638
Genome map
AA seq 113 aa AA seqDB search
MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKNEATPEAEQVKKEEQ
NIADGVEQKKTEAANKVEETKKQASAAVSEKKETKKEGGFLKKLNRKIASIFN
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattcaaaacaaagctgaaactgccgcccaagatgtccaacaaaagttggaa
gaaaccaaagaatctttgcaaaacaagggccaagaagtaaaggaacaagctgaagcttct
atcgacaacctaaaaaatgaagctactccagaagctgaacaggtgaagaaggaagaacaa
aacattgctgatggtgtcgaacaaaagaagaccgaagctgccaacaaagttgaagaaact
aagaagcaagcttccgccgccgtcagtgagaagaaggaaaccaagaaggaaggcggtttc
ttgaagaaattgaaccgtaaaattgcttccattttcaactaa

DBGET integrated database retrieval system