KEGG   Saccharomyces cerevisiae (budding yeast): YOL133WHelp
Entry
YOL133W           CDS       T00005                                 

Gene name
HRT1, HRT2, RBX1, ROC1
Definition
(RefSeq) SCF ubiquitin ligase complex subunit HRT1
  KO
K03868  RING-box protein 1 [EC:2.3.2.32]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03420  Nucleotide excision repair
sce04111  Cell cycle - yeast
sce04120  Ubiquitin mediated proteolysis
sce04141  Protein processing in endoplasmic reticulum
Module
sce_M00379  SCF-MET30 complex
sce_M00407  SCF-CDC4 complex
sce_M00411  SCF-GRR1 complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YOL133W (HRT1)
   04120 Ubiquitin mediated proteolysis
    YOL133W (HRT1)
  Replication and repair
   03420 Nucleotide excision repair
    YOL133W (HRT1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YOL133W (HRT1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     YOL133W (HRT1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   YOL133W (HRT1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     YOL133W (HRT1)
   ECV complex
     YOL133W (HRT1)
   Cul3 complex
     YOL133W (HRT1)
   Cul4 complex
     YOL133W (HRT1)
   Cul7 complex
     YOL133W (HRT1)
   Cul9 complex
     YOL133W (HRT1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      YOL133W (HRT1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      YOL133W (HRT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_4
Motif
Other DBs
NCBI-GeneID: 853986
NCBI-ProteinID: NP_014508
SGD: S000005493
UniProt: Q08273
Position
XV:70325..70690
Genome map
AA seq 121 aa AA seqDB search
MSNEVDRMDVDEDESQNIAQSSNQSAPVETKKKRFEIKKWTAVAFWSWDIAVDNCAICRN
HIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQPWQLARCG
R
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaagttgacaggatggatgttgatgaagatgaatcgcaaaatattgcgcaa
agctcaaaccaaagtgcgccagtggaaaccaaaaagaagagatttgaaattaagaaatgg
accgcagtggcgttttggtcatgggatatagctgttgacaactgtgctatttgcaggaac
catataatggaaccatgcattgaatgccagccaaaggccatgacggacactgataatgaa
tgtgtagcagcctggggtgtctgtaatcacgctttccatttgcactgtattaataaatgg
atcaagacaagagacgcatgcccattagataaccaaccttggcagttagcaagatgcggt
aggtga

DBGET integrated database retrieval system