KEGG   Saccharomyces cerevisiae (budding yeast): YPL244C
Entry
YPL244C           CDS       T00005                                 

Symbol
HUT1
Name
(RefSeq) UDP-galactose transporter HUT1
  KO
K15275  solute carrier family 35 (UDP-galactose transporter), member B1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YPL244C (HUT1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   YPL244C (HUT1)
SSDB
Motif
Pfam: UAA TPT EamA Nuc_sug_transp Orf78
Other DBs
NCBI-GeneID: 855832
NCBI-ProteinID: NP_015080
SGD: S000006165
UniProt: Q12520
Position
XVI:complement(87014..88033)
AA seq 339 aa
MAGSTSSLVICAIGIYATFLTWALVQEPLATRTWPNSMGKFQFPNVISLIQASVAMMMGY
LYLNWKKVEYPPRKMIKDHWKQLMLISFTQSSSGPLATTSLKHVDYLTYMLAKSCKMIPV
LLVHLLLYRTPIASQKKVVALLVSLGVTIFTIGGNDGKKLKRSFNESGNDNKLQGFGLLF
SSLFLDGLTNATQDKLLKANKAKEKGKQTLITGAHLMFTLNLFVILWNILYFIVIDCKQW
DNAVSVLTMDPQVWGYLMLYSFCGAMGQCFIFYTLEQFGSLVLIMITVTRKMVSMILSII
VFGKSVRFQQWVGMFIVFGGITWEALNKKKANIPKAKSA
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcgggaagtacatccagtttggtgatctgtgcgattggtatatatgctacttttttg
acgtgggcattagtacaggagcctttggctacaagaacctggccaaactccatgggaaag
tttcaattccctaatgtaatatccctcatacaagcttctgtggcaatgatgatgggctac
ctgtacttaaactggaagaaggtggaatatccgcccagaaaaatgattaaagatcattgg
aaacaattgatgttgatatcatttacacagagtagttcaggcccgctggctacaacttct
ttaaagcacgtggattatctcacttacatgttagcaaagtcatgcaagatgatccccgtg
ttgttggtgcatttgcttttgtataggacgcccatagcaagccaaaaaaaagttgtagct
ctcttggtaagtctcggtgtcactattttcactataggtggcaacgatggtaaaaagttg
aagagatcctttaatgagagcggaaatgataacaaattacaagggtttggactacttttc
tctagtttattccttgatggattgaccaacgccacccaagataagctactaaaggccaat
aaggccaaagaaaagggaaaacaaactttgataacaggtgcacacttgatgtttacactg
aacctcttcgtgatattgtggaatattttgtattttattgtgatcgactgcaaacaatgg
gataatgccgtttctgtattgacgatggacccacaagtgtggggctatttaatgctttat
tcgttctgtggcgctatgggacaatgctttattttctatactctagaacaatttggctct
ttagttttgatcatgataacagtcaccaggaaaatggtctcgatgattttgagtattatt
gtcttcggtaagagtgtacgtttccagcaatgggtggggatgtttatagtatttggtgga
atcacttgggaagcactcaacaagaagaaggctaatataccgaaggcaaaatctgcgtag

DBGET integrated database retrieval system