KEGG   Saccharomyces cerevisiae (budding yeast): YPR056WHelp
Entry
YPR056W           CDS       T00005                                 

Gene name
TFB4
Definition
(RefSeq) TFIIH/NER complex subunit TFB4
  KO
K03143  transcription initiation factor TFIIH subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
sce03420  Nucleotide excision repair
Module
sce_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    YPR056W (TFB4)
  09124 Replication and repair
   03420 Nucleotide excision repair
    YPR056W (TFB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YPR056W (TFB4)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YPR056W (TFB4)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YPR056W (TFB4)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     YPR056W (TFB4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tfb4 FbpA Rad50_zn_hook
Motif
Other DBs
NCBI-GeneID: 856169
NCBI-ProteinID: NP_015381
SGD: S000006260
UniProt: Q12004
Structure
PDB: 

Position
XVI:671126..672142
Genome map
AA seq 338 aa AA seqDB search
MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF
LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRN
VDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLT
CGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVES
TEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIP
PGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKKKVTKP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaatatctgatccaacgtttaagcatgctagatcaagaaaacaggttactgaa
gaatcaccatctttgcttaccgttattatagaaattgcaccaaagttatggacaactttt
gatgaggaaggaaatgagaaaggaagtataataaaggttttagaggcattgatagtattt
ctcaatgctcacttagcgttcaatagcgccaacaaagtagcagtcattgctgcatactct
cagggaatcaaatatttatacccagagagcacatctgctctaaaagcctctgaatctgaa
aataaaacccgtagtgatcttaagattattaactcagatatgtatagacgttttagaaac
gttgatgagacgctagtggaagaaatatataaactatttgagttagaaaagaaacaaatc
gaacaaaatagtcaaaggagcacgctagcaggtgccatgtcagctgggctgacttatgta
aacagaatatcaaaagagtcagtaactacctcattaaaatcaaggctacttgttcttacg
tgcgggagtggcagtagtaaagatgaaattttccaatacatccctataatgaactgtatt
ttttccgcaacaaaaatgaaatgtcccattgatgtcgtaaagattggtggttctaaggaa
agcacgtttttacagcaaacgacggatgccacaaatggcgtttatttacatgttgaatct
acagaagggctaattcaatatttagcaactgcaatgtttattgatccgtcgttaagacct
ataattgttaagccaaaccatggatctgtagattttaggacatcatgctatttaacaggg
agagttgttgccgttggattcatctgttcagtttgcctatgtgtcttatcaatcataccg
cccggaaataaatgtcctgcttgtgattctcaatttgatgagcacgtaattgccaagttg
aagaggaaaccagttgttccaaggttgaaagccaaaaagaaggtgacgaaaccatga

DBGET integrated database retrieval system