KEGG   Streptomyces coelicolor: SCO1709
Entry
SCO1709           CDS       T00085                                 

Symbol
SCI30A.30c
Name
(RefSeq) integral membrane transport protein
Organism
sco  Streptomyces coelicolor
SSDB
Motif
Pfam: MFS_1 MFS_4 MFS_1_like Collagen DUF3318 MFS_3
Other DBs
NCBI-GeneID: 1097140
Kitasato: SCO1709
UniProt: Q9S243
Position
complement(1828915..1830306)
AA seq 463 aa
MVPSGNRGWLLRLVIAFGFAQAAVSMARPAVSYRALALGADERAVGVIAGVYALLPLFAA
VPLGRRTDHGRCAPLLPAGVVLIAGGCALSGVAGSLSTMALWSGVMGLGHLCFVIGAQSL
VARQSAPHEQDRNFGHFTIGASLGQLIGPIAAGALIGGPDMAGSSALALVVAGAGAAVAF
TSLWRTEHPGAAKSRAQQGARVPVVSILRARGVPAGILISLSVLSATDILTAYLPVVGEQ
RGISPAVIGVLLSLRAAATIACRLVLTPLLRLLGRTVLLTVTCLLAALLCAGVALPVPVW
ALALMLVVLGFCLGVGQPLSMTTVVQAAPDEARSTALALRLTGNRLGQVAAPAAAGLIAG
VAGVAAPFVMLGALLLLSSGVALRSPSTGTTGTTGAGGAGGAGGAGGTTGTAGASGASGA
SGASGASGASGATGRAAGPRSPEIGQDVPDRAGDSRPCRESRG
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggtgcccagtgggaaccgcggctggctgctccgcctcgtcatcgccttcggcttcgca
caggccgcggtgtcgatggcccggcccgccgtctcctaccgggccctcgcgctgggcgcg
gacgaacgggccgtcggtgtcatcgccggggtgtacgcgctgctgccgctgttcgccgcc
gttccgctgggccgccgcaccgaccacgggcgctgcgcaccgctgctgcccgccggggtg
gtgctcatcgccgggggctgtgcgctgagcggcgtcgccggctccctgtcgacgatggcc
ctgtggagcggcgtcatgggcctcggccacctctgcttcgtcatcggcgcccagtcactg
gtcgcccgccagtccgcgccgcacgaacaggaccgcaacttcggccacttcaccatcggc
gcctcgctcggccagctgatcggccccatcgccgcgggcgcgctcatcggcggccccgac
atggccggcagcagcgcgctcgccctggtggtggcgggcgcgggcgcggcggtcgccttc
acgtccctgtggcgcacagagcaccccggggccgccaagtcccgtgcgcagcagggtgcg
cgcgtccccgtggtgagcatcctgcgcgcccggggcgtgcccgcgggcatcctgatcagc
ctctccgtgctctccgccaccgacatcctcaccgcctacctgccggtggtcggcgagcag
cggggaatctccccggccgtgatcggcgtactgctcagcctgcgggccgccgcgacgatc
gcctgccggctcgtgctgacgcccctgctgcggctgctcggccgcacggtgctgctcacg
gtcacgtgtctgctggccgccctgctgtgcgccggggtcgcgctgccggtgccggtgtgg
gcgctcgccctgatgctggtcgtcctcggcttctgcctgggcgtcggccagccgctctcc
atgaccacggtcgtgcaggcggcccccgacgaggcgcgctccacggccctcgccctgcgc
ctgaccggcaaccgcctcggccaggtcgccgcccccgccgccgcgggcctgatcgcgggc
gtcgcgggtgtggcggcgcccttcgtgatgctgggcgcgctcctcctgctctcctcgggc
gtcgccctgcgttcgccgtcgaccgggacgaccgggacgaccggtgcgggcggtgcgggc
ggtgcgggcggtgcgggcggtacgacgggtacggccggtgcgtccggtgcgtccggtgcg
tccggtgcgtccggtgcgtccggtgcgtccggtgcgaccggtcgggccgccgggccccgg
agtccggagatcgggcaggatgtcccggaccgggcgggcgacagccggccgtgccgggag
tcgaggggatga

DBGET integrated database retrieval system