KEGG   Streptomyces coelicolor: SCO1709Help
Entry
SCO1709           CDS       T00085                                 

Gene name
SCI30A.30c
Definition
(RefSeq) integral membrane transport protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_4 MFS_1_like Collagen DUF3318 MFS_3 Sugar_tr
Motif
Other DBs
NCBI-GeneID: 1097140
NCBI-ProteinID: NP_625983
Kitasato: SCO1709
UniProt: Q9S243
Position
complement(1828915..1830306)
Genome map
AA seq 463 aa AA seqDB search
MVPSGNRGWLLRLVIAFGFAQAAVSMARPAVSYRALALGADERAVGVIAGVYALLPLFAA
VPLGRRTDHGRCAPLLPAGVVLIAGGCALSGVAGSLSTMALWSGVMGLGHLCFVIGAQSL
VARQSAPHEQDRNFGHFTIGASLGQLIGPIAAGALIGGPDMAGSSALALVVAGAGAAVAF
TSLWRTEHPGAAKSRAQQGARVPVVSILRARGVPAGILISLSVLSATDILTAYLPVVGEQ
RGISPAVIGVLLSLRAAATIACRLVLTPLLRLLGRTVLLTVTCLLAALLCAGVALPVPVW
ALALMLVVLGFCLGVGQPLSMTTVVQAAPDEARSTALALRLTGNRLGQVAAPAAAGLIAG
VAGVAAPFVMLGALLLLSSGVALRSPSTGTTGTTGAGGAGGAGGAGGTTGTAGASGASGA
SGASGASGASGATGRAAGPRSPEIGQDVPDRAGDSRPCRESRG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccagtgggaaccgcggctggctgctccgcctcgtcatcgccttcggcttcgca
caggccgcggtgtcgatggcccggcccgccgtctcctaccgggccctcgcgctgggcgcg
gacgaacgggccgtcggtgtcatcgccggggtgtacgcgctgctgccgctgttcgccgcc
gttccgctgggccgccgcaccgaccacgggcgctgcgcaccgctgctgcccgccggggtg
gtgctcatcgccgggggctgtgcgctgagcggcgtcgccggctccctgtcgacgatggcc
ctgtggagcggcgtcatgggcctcggccacctctgcttcgtcatcggcgcccagtcactg
gtcgcccgccagtccgcgccgcacgaacaggaccgcaacttcggccacttcaccatcggc
gcctcgctcggccagctgatcggccccatcgccgcgggcgcgctcatcggcggccccgac
atggccggcagcagcgcgctcgccctggtggtggcgggcgcgggcgcggcggtcgccttc
acgtccctgtggcgcacagagcaccccggggccgccaagtcccgtgcgcagcagggtgcg
cgcgtccccgtggtgagcatcctgcgcgcccggggcgtgcccgcgggcatcctgatcagc
ctctccgtgctctccgccaccgacatcctcaccgcctacctgccggtggtcggcgagcag
cggggaatctccccggccgtgatcggcgtactgctcagcctgcgggccgccgcgacgatc
gcctgccggctcgtgctgacgcccctgctgcggctgctcggccgcacggtgctgctcacg
gtcacgtgtctgctggccgccctgctgtgcgccggggtcgcgctgccggtgccggtgtgg
gcgctcgccctgatgctggtcgtcctcggcttctgcctgggcgtcggccagccgctctcc
atgaccacggtcgtgcaggcggcccccgacgaggcgcgctccacggccctcgccctgcgc
ctgaccggcaaccgcctcggccaggtcgccgcccccgccgccgcgggcctgatcgcgggc
gtcgcgggtgtggcggcgcccttcgtgatgctgggcgcgctcctcctgctctcctcgggc
gtcgccctgcgttcgccgtcgaccgggacgaccgggacgaccggtgcgggcggtgcgggc
ggtgcgggcggtgcgggcggtacgacgggtacggccggtgcgtccggtgcgtccggtgcg
tccggtgcgtccggtgcgtccggtgcgtccggtgcgaccggtcgggccgccgggccccgg
agtccggagatcgggcaggatgtcccggaccgggcgggcgacagccggccgtgccgggag
tcgaggggatga

DBGET integrated database retrieval system