KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1966
Entry
SPUL_1966         CDS       T01740                                 

Gene name
sopB
Definition
(GenBank) cell invasion protein
  KO
K13085  phosphatidylinositol-4,5-bisphosphate 4-phosphatase [EC:3.1.3.78]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel05100  Bacterial invasion of epithelial cells
sel05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sel00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    SPUL_1966 (sopB)
   05100 Bacterial invasion of epithelial cells
    SPUL_1966 (sopB)
Enzymes [BR:sel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.78  phosphatidylinositol-4,5-bisphosphate 4-phosphatase
     SPUL_1966 (sopB)
SSDB
Motif
Pfam: IpgD Y_phosphatase3
Other DBs
NCBI-ProteinID: AET54294
Structure
PDB: 
4DID

Position
1958022..1959707
AA seq 561 aa
MQIQSFYHSASLKTQEAFKSLQKTLYNGMQILSGQGKAPAKAPDARPEIIVLREPGATWG
NYLQHQKTSNHSLHNLYNLQRDLLTVAATVLGKQDPVLTSMANQMELAKVKADRPATKQE
EAAAKALKKNLIELIAARTQQQDGLPAKEAHRFAAVAFRDAQVKQLNNQPWQTIKNTLTH
NGHHYTNTQLPAAEMKIGAKDIFPSAYEGKGVCSWDTKNIHHANNLWMSTVSVHEDGKDK
TLFCGIRHGVLSPYHEKDPLLRHVGAENKAKEVLTAALFSKPELLNKALAGEAVSLKLVS
VGLLTASNIFGKEGTMVEDQMRAWQSLTQPGKMIHLKIRNKDGDLQTVKIKPDVAAFNVG
VNELALKLGFGLKASDSYNAEALHQLLGNDLRPEARPGGWVGEWLAQYPDNYEVVNTLAR
QIKDIWKNNQHHKDGGEPYKLAQRLAMLAHEIDAVPAWNCKSGKDRTGMMDSEIKREHIS
LHQTHMLSAPGSLPDSGGQKIFQKVLLNSGNLEIQKQNTGGAGNKVMKNLSPEVLNLSYQ
KRVGDENIWQSVKGISSLITS
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgcaaatacagagcttctatcactcagcttcactaaaaacccaggaggcttttaaaagc
ctacaaaaaaccttatacaacggaatgcagattctctcaggccagggcaaagcgccggct
aaagcgcccgacgctcgcccggaaattattgtcctgcgagaacctggcgcgacatggggg
aattatctacagcatcagaagacgtctaaccactcgctgcataacctctataacttacag
cgcgatcttcttaccgtcgcggcaaccgttctgggtaaacaagacccggttctaacgtca
atggcaaaccaaatggagttagccaaagttaaagcggaccggccagcaacaaaacaagaa
gaagccgcggcaaaagcattgaagaaaaatcttatcgaacttattgcagcacgcactcag
cagcaggatggcttacctgcaaaagaagctcatcgctttgcggcagtagcgtttagagat
gctcaggtcaagcagcttaataaccagccctggcaaaccataaaaaatacactcacgcat
aacgggcatcactataccaacacgcagctccctgcagcagagatgaaaatcggcgcaaaa
gatatctttcccagtgcttatgagggaaagggcgtatgcagttgggataccaagaatatt
catcacgccaataatttgtggatgtccacggtgagtgtgcatgaggacggtaaagataaa
acgcttttttgcgggatacgtcatggcgtgctttccccctatcatgaaaaagatccgctt
ctgcgtcacgtcggcgctgaaaacaaagccaaagaagtattaactgcggcactttttagt
aaacctgagttgcttaacaaagccttagcgggcgaggcggtaagcctgaaactggtatcc
gtcgggttactcaccgcgtcgaatattttcggcaaagagggaacgatggtcgaggaccaa
atgcgcgcatggcaatcgttgacccagccgggaaaaatgattcatttaaaaatccgcaat
aaagatggcgatctacagacggtaaaaataaaaccggacgtcgccgcatttaatgtgggt
gttaatgagctggcgctcaagctcggctttggccttaaggcatcggatagctataatgcc
gaggcgctacatcagttattaggcaatgatttacgccctgaagccagaccaggtggctgg
gttggcgaatggctggcgcaatacccggataattatgaggtcgtcaatacattagcgcgc
cagattaaggatatatggaaaaataaccaacatcataaagatggcggcgaaccctataaa
ctcgcacaacgccttgccatgttagcccatgaaattgacgcggtacccgcctggaattgt
aaaagcggcaaagatcgtacaggaatgatggattcagaaatcaagcgagagcacatttct
ttacatcagacccatatgttaagtgcgcctggtagtcttccggatagcggtggacagaaa
attttccaaaaagtattactgaatagcggtaacctggagattcagaaacaaaatacgggc
ggggcgggaaacaaagtaatgaaaaatttatcgccagaggtgctcaatctttcctatcaa
aaacgagttggggatgaaaatatttggcagtcagtaaaaggcatttcttcattaatcaca
tcttga

DBGET integrated database retrieval system