KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1993
Entry
SPUL_1993         CDS       T01740                                 

Gene name
uup
Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K15738  ABC transport system ATP-binding/permease protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sel02000]
    SPUL_1993 (uup)
Transporters [BR:sel02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Other ABC transporters
    SPUL_1993 (uup)
SSDB
Motif
Pfam: ABC_tran ABC_tran_CTD AAA_21 ABC_tran_Xtn SMC_N AAA_22 AAA_15 AAA_23 AAA_29 RsgA_GTPase AAA_16 TsaE AAA_33 AAA_18 RNA_helicase AAA_30 AAA_28 MMR_HSR1 AAA AAA_24 NACHT AAA_7 AAA_14 PduV-EutP ATP-synt_ab AAA_25 AAA_5 ATPase_2 AAA_13 NB-ARC MobB Rad17 IstB_IS21 Dynamin_N T2SSE AAA_19 Ploopntkinase3 Rx_N Lipocalin_2 Mis14
Other DBs
NCBI-ProteinID: AET54321
Position
complement(1984013..1985920)
AA seq 635 aa
MSLISMHGAWLSFSDAPLLDNAELHIEDNERVCLVGRNGAGKSTLMKILNREQGLDDGRI
IYEQDLIVARLQQDPPRNIAGSVYDFVAEGIEEQAEYLKRYHEISRLVMTDPSEKNLNEM
ARVQEQLDHHNLWQLENRINEVLAQLGLDPNAALSSLSGGWLRKAALGRAMVSNPRVLLL
DEPTNHLDIETIDWLEGFLKTFNGTIIFISHDRSFIRNMATRIVDLDRGKLVTYPGNYDQ
YLLEKEEALRVEELQNAEFDRKLAQEEVWIRQGIKARRTRNEGRVRALKAMRRERSERRE
VMGTAKMQVEEATRSGKIVFEMENVDYQVEGKQLVKDFSAQVQRGDKIALIGPNGCGKTT
LLKLMLGQLQADSGRIHVGTKLEVAYFDQHRAELDPEKTVMDNLAEGKQEVMVNGKPRHV
LGYLQDFLFHPKRAMTPVRALSGGERNRLLLARLFLKPSNLLILDEPTNDLDVETLELLE
ELIDGYQGTVLLVSHDRQFVDNTVTECWIFEGGGKIGRYIGGYHDARAQQEQHLATKQPM
AKKNEEVIAPKAEIVKRGSSKLSYKLQRELEQLPGQLEDLEAKLEALQAQVADAAFFSQP
HEQTQKVLADLSQAEQELEQAFERWEYLEGLKNGA
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgtcattaatcagtatgcatggcgcatggctgtcgttcagcgacgcgccgcttctcgat
aacgcagagttgcatatcgaagataacgaacgcgtctgtctggtggggcgtaacggcgcc
gggaaatccaccttgatgaagatcctcaaccgcgaacagggtctggacgatgggcgtatt
atttatgagcaggatctgatcgtcgcgcgtctgcaacaggacccgccccgtaatattgcg
ggcagcgtctatgactttgtcgccgaaggtatcgaagaacaagcggaatacctcaagcgc
tatcatgagatttcccgtctggtgatgaccgatcccagcgagaaaaacctcaatgaaatg
gcgcgcgtacaggaacagctcgatcatcataatctgtggcagctggaaaaccgtattaat
gaagtgctggcgcagcttggactcgatcctaacgccgcgctgtcgtcgctctccggcggc
tggctgcgtaaagccgcgctgggtcgggcgatggtcagcaatccgcgcgtattgttactg
gatgaaccgactaaccatctggatatcgaaactatcgactggctggaagggtttctgaaa
acctttaacggaacgattatttttatctctcacgatcgttcgtttattcgcaatatggcg
acccgcattgtcgatctcgatcgtggcaaactggtcacctatccgggaaattacgatcaa
tacctgctggagaaagaagaagcgctgcgcgtagaagagttacaaaacgcggaatttgat
cgcaaactggcgcaggaagaagtctggattcgccaggggatcaaggcgcgccgcacccgt
aatgaagggcgcgtgcgggcgttaaaagcgatgcgtcgtgaacgcagcgagcgccgggaa
gtgatgggcacggcgaagatgcaggtcgaagaggcgacgcgctccggtaaaatcgttttt
gagatggaaaacgtcgattaccaggtagaaggaaaacaactggtaaaagatttctccgct
caggtacagcgcggtgacaagattgcgttaattggcccgaacggctgcggtaaaaccacg
ctactgaaactgatgctgggacagcttcaggctgacagcgggcgcatccacgtaggaacg
aagctggaagtcgcctacttcgatcagcatcgcgccgaactggacccggaaaaaaccgtg
atggataacctggcggaaggcaagcaggaggtgatggtaaacggtaagccgcgccatgta
ctgggctatttgcaggacttcctgtttcaccccaaacgggcgatgacgcccgtccgcgcg
ctttccggcggcgaacgtaaccgtctgctgctggcgcgactgttcctcaagccgagcaat
cttttaattctcgatgaaccaacgaacgatcttgacgtcgaaacgctggaactattagaa
gaattaattgatggctatcagggcacggtactactggtcagccacgatcggcaatttgtc
gataataccgtgacggaatgctggattttcgagggcggcggcaaaatcggacgttatatc
ggcggctaccatgatgcgcgtgcgcagcaagagcagcatctggcgacgaaacagccgatg
gcgaaaaaaaatgaggaagttattgcccctaaagcagaaattgtaaaacgtggcagtagc
aaactaagctataaactgcagcgcgagctggagcagttacccggtcagcttgaagacctg
gaagcgaagctggaagcgctacaggcgcaggttgcggatgcggccttttttagccaaccc
catgagcaaacgcaaaaagttctggccgatttaagtcaggcggagcaagaacttgagcaa
gccttcgaacgttgggagtatcttgaaggcctgaaaaacggggcataa

DBGET integrated database retrieval system