KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2004
Entry
SPUL_2004         CDS       T01740                                 

Definition
(GenBank) putative transcriptional regulator
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: HTH_24 AsnC_trans_reg HTH_AsnC-type HTH_11 MarR_2 HTH_Crp_2 MarR HTH_5 HTH_20 HTH_IclR HTH_23 HTH_34 HTH_28 Rrf2 GYD LexA_DNA_bind HTH_Tnp_ISL3 Sigma70_r4_2 HTH_29 HTH_36 Sigma70_r4 HTH_27 HTH_1 HTH_DeoR HTH_Mga TrmB RepL HTH_38 HTH_3 Fe_dep_repress HTH_9 GntR
Other DBs
NCBI-ProteinID: AET54332
Position
1998545..1999006
AA seq 153 aa
MKLDAWDKNILTLLQRDNRLSQREIAEQVNLSPSAVNRRIAALEEAGIIKGNVSLIDAGK
VGRPVTIVVQVVIENERFNLLEEARQRFVSCPQVQQVYYVTGDFDFLLVLNVRDMAEYEA
LTRELFFSSGNIKSFKTIVVMQNAKQEMRVLIE
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaagcttgacgcctgggataaaaacattctgacattattgcagcgcgataatcgtctt
tctcagcgggaaatcgccgaacaggtcaatctttcaccttcggcagtgaatcgtcgtatc
gcggcactggaggaggcgggcataattaaaggcaatgtcagccttattgatgctggcaaa
gtgggacgcccggtcacgattgtggtgcaggtggtgatcgaaaacgagcgattcaattta
ctggaagaggctcgtcaacggtttgtcagttgcccgcaggtgcagcaggtctactacgta
acgggcgatttcgactttttactggtgctcaatgttcgtgacatggcggaatatgaagcg
cttacccgtgagcttttcttttcctcaggcaatattaagtcttttaaaacgattgtcgtg
atgcaaaacgccaagcaagagatgcgcgtcctgatcgagtaa

DBGET integrated database retrieval system