KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2012
Entry
SPUL_2012         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K21470  L,D-transpeptidase YcbB
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sel01002]
    SPUL_2012
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sel01011]
    SPUL_2012
Peptidases and inhibitors [BR:sel01002]
 Cysteine peptidases
  Family C82
   SPUL_2012
Peptidoglycan biosynthesis and degradation proteins [BR:sel01011]
 Peptidoglycan biosynthesis and degradation
  Transpeptidase
   SPUL_2012
SSDB
Motif
Pfam: YkuD PG_binding_1
Other DBs
NCBI-ProteinID: AET54339
Position
complement(2005211..2007061)
AA seq 616 aa
MLLNKMCGRCLSAISLCLAVTFAPLFNAQADEPEMIPGDSAVAAPDLAGPQKQSAATAIM
AGIQPLPEGVSAEKVRADLQSQLPSGYTPVYMSQLTLLYAARDMKPMWDNRDAVKVFQQQ
LAEVAIAGFQPQFTAWVALLTDPAVNGMARDVVLSDAMMGYLHFIANIPVKGQRWLYSNK
PYALATPPVSVINQWQIALEEGQLPMFVASLAPQHPQYAPMHDALLKLVADSRPWPQLAN
TATLRPGQWSNDVPALREILQRTGMLDGGPKIALPGDNTADSAVVSPSAVVDETSVAQPV
DEQTARRSKPAPAVRAAYDNELVEAVKRFQAWQGLGADGVIGPATRNWLNMTPAQRAGVL
ALNIQRLRLLPAELSTGIMVNIPAYSLVYYQNGNQVLASRVIVGRPDRKTPMMSSALNNV
VVNPPWNVPPTLARKDILPKVWNDPGYLERHGYTVMRGWNSKEAIDPWQVDWTTITPSNL
PFRFQQAPGAHNSLGRYKFNMPSSDAIYLHDTPNHTLFQRDARALSSGCVRVNKASELAN
MLLQDAGWNDARISGALKQGDTRYVNIRQNIPVNLYYLTAFVGADGRMQYRTDIYNYDLT
ARSSAQIVPKVEQLIR
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgttgcttaacaagatgtgtggtcgttgtctgtcggcaatcagtttatgcctggccgta
acattcgctccactgttcaatgcgcaggccgatgagcctgaaatgatacctggcgatagc
gccgttgccgcgccggatctagctgggccgcagaagcaatcagccgcgacggcgattatg
gccgggattcagccgctgccggagggcgtttcagccgagaaagtccgggctgatttacag
tcgcagcttccttccggctatacgccggtctatatgagccagctgacattgctgtatgcc
gcgcgcgacatgaagcccatgtgggataatcgcgatgcggtgaaagtcttccagcaacag
ttggcggaggtggcgattgccggattccagccgcagtttaccgcctgggtggcattgttg
accgatcccgccgtaaacggtatggcgcgcgatgttgtgttgtcagacgctatgatgggc
tatctccatttcattgcgaatatccccgtcaaaggccagcgctggttatatagcaacaaa
ccttacgcattggcgacgccgccagtctcggtgattaaccagtggcaaatcgcgctggaa
gaggggcagttgccgatgtttgtcgccagcctggcgccgcagcatccacagtatgcgccc
atgcatgacgcgctgctgaagctggtggcggactctcgcccgtggccgcagttggccaat
accgcaacgctgcgcccggggcaatggagtaacgatgtgcctgcgctgcgcgaaatatta
cagcgtacggggatgctggatggcggtccaaagatagccttacccggcgataacactgct
gatagcgccgtcgtcagcccctccgccgtggtcgacgaaacatcggtggcgcagccggtc
gacgaacaaacggcccgccgtagtaagccggctccggcggtacgcgccgcctacgataat
gaactggtcgaggcggtaaagcgttttcaggcatggcaagggctgggggcggatggcgtt
attggcccggcgacgcgtaactggcttaatatgacccccgcgcaacgcgcaggcgtactg
gcactgaatatccaacgtttacgcctgctgccggcggaactctctaccggtattatggta
aacattcccgcttattcgctggtctactatcagaatggcaaccaggtgctggcttcgagg
gtgatcgtcgggcgtcccgatcgtaaaacgccgatgatgagcagcgcgctgaataatgtg
gtggtgaacccgccgtggaacgttccgcccacgcttgcgcgtaaagacattttaccgaag
gtgtggaatgacccaggctatctggagcgccatggctacaccgtgatgcgcggctggaac
agcaaagaagcgatcgatccgtggcaggttgactggaccaccattacgccatcgaatctt
ccgttccgtttccagcaggcgccaggcgcgcacaattcgctggggcgttataaatttaat
atgccgagctctgatgcgatctatctgcacgatacgcctaaccatactctctttcagcgt
gacgccagggcgttaagttccggctgcgtgcgggtcaataaggcctctgaactggcgaat
atgctcttgcaggatgctggctggaacgatgcgcggatctcaggcgccctgaagcaaggc
gacacgcggtatgtcaatatccggcagaacattccagtaaatctttactatctgaccgcg
tttgtcggcgcagatggacgtatgcaatatcgtacagatatttacaattacgatctcaca
gcgcgatccagcgcacaaattgtgccaaaggttgaacaattaatcaggtaa

DBGET integrated database retrieval system