KEGG   Streptomyces pratensis: Sfla_1254Help
Entry
Sfla_1254         CDS       T01647                                 

Definition
(GenBank) transcriptional regulator, XRE family
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00520  Amino sugar and nucleotide sugar metabolism
sfa00550  Peptidoglycan biosynthesis
sfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sfla_1254
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sfla_1254
Enzymes [BR:sfa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Sfla_1254
Peptidoglycan biosynthesis and degradation proteins [BR:sfa01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Sfla_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase HTH_3 HTH_31 HTH_37 HTH_19 YdaS_antitoxin Sigma70_r4 HTH_26 HTH_25 HTH_23 MarR
Motif
Other DBs
NCBI-ProteinID: ADW02704
UniProt: E8W149
Position
1475410..1476939
Genome map
AA seq 509 aa AA seqDB search
MEDDYLARIGKLIRDARQHRGWTQSQLAEALATSQSAVNRIERGNQNISLEMIARIGEAL
DSEIVSLGYAGPMHLRVVGGRRLSGSIDVKTSKNACVALLCGSLLNKGRTVLRRVARIEE
VFRLLEVLNSIGVRTRWINEGVDLEILPPAELDLDAIDADAARRTRSIIMFLGPLLHRTD
RFTLPYAGGCDLGTRTIEPHMIALRRFGLEIAATDGLYHAQVDHEVRPDRPIVLTERGDT
VTENALLAAARHDGTTVIRNASSNYMVQDLCFFLEALGVRVEGVGTTTLTVHGVPEIDVD
VDYSPSEDPVEAMSLLAAAVVTESELTIRRVPIEFLEIELAVLEEMGVDCDRTAEYSADN
GRTRLVDLTVRPSKLEAPIDKIHPMPFPGLNIDNVPFFAAIAASAHGQTLIHDWVYDNRA
IYLTDLNRLGGRLQLLDPHRVLVEGPTRWRAAEMMCPPALRPAVVVLLAMMAAEGTSVLR
NVYVINRGYEELAERLNSVGAQIEIFRDI
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgactacctcgcacgtatcggcaagctcatccgtgacgcccgtcagcatcgt
ggctggacacagagtcagctggccgaggcgctcgccacgagccagagcgccgtcaaccgc
atcgagcgcggcaaccagaacatcagccttgagatgatcgcccgcatcggcgaagccctc
gacagcgagatcgtgtcgctcggctacgccggacccatgcatctgcgtgtggtcggcgga
cgccggctctccggctccatcgacgtcaagacgagcaagaacgcgtgtgtcgcgctgctc
tgcggctccctgctcaacaaggggcgcacggtcctgcgccgggtggcgcgcatcgaggag
gtcttccggctcctggaggtcctcaactccatcggcgtacgcacccgctggatcaacgag
ggcgtcgacctggagatcctgccgcccgccgagctcgacctggacgccatcgacgcggac
gccgcgcgccggacccgctcaatcatcatgttcctcggcccgctgctgcaccgcacggac
cgcttcaccctcccgtacgccggaggctgcgacctcggcacgcggacgatcgagccgcac
atgatcgcgctgcgccgcttcggcctggagatcgccgcgaccgacgggctgtaccacgca
caggtcgaccacgaggtccggccggaccgccccatcgtactgaccgaacgcggcgacacg
gtgaccgagaacgccctgctggccgccgcccggcacgacggcacgaccgtcatccgcaac
gcctcctccaactacatggtccaggacctgtgcttcttcctggaggcgctcggcgtgcgc
gtcgagggcgtcgggacgacgacgctcacggtgcacggcgtgccggagatcgacgtggac
gtcgactactccccctccgaggacccggtcgaggcgatgagcctgctggccgccgccgtg
gtgacggagtccgagctgacgatccgccgggtcccgatcgagttcctggagatcgagctc
gccgtcctggaggagatgggcgtcgactgcgaccgcacggcggagtactcggccgacaac
ggccgcacccggctggtggacctgacggtccggccctccaagctggaggccccgatcgac
aagatccacccgatgccgttccccggcctgaacatcgacaacgtgccgttcttcgcggcc
atcgcggcctccgcccacggccagaccctgatccacgactgggtctacgacaaccgcgcg
atctacctcacggacctcaaccgcctcggtggcaggctccagctgctggacccgcaccgc
gtcctggtcgagggcccgacccgctggcgcgccgccgagatgatgtgcccgccggccctg
cggcccgcggtggtggtgctgctggcgatgatggcggccgagggcacgtccgtgctccgc
aacgtatatgtgatcaaccggggttacgaggagctggcggagcggctgaactcggtgggg
gcgcagatcgagatcttccgggacatctga

DBGET integrated database retrieval system