KEGG   Streptomyces pratensis: Sfla_3301Help
Entry
Sfla_3301         CDS       T01647                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K22322  A-factor type gamma-butyrolactone 1'-reductase (1S-forming) [EC:1.1.1.413]
Organism
sfa  Streptomyces pratensis
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sfla_3301
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.413  A-factor type gamma-butyrolactone 1'-reductase (1S-forming)
     Sfla_3301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ADW04722
UniProt: E8WE02
Position
3823252..3824016
Genome map
AA seq 254 aa AA seqDB search
MSDLLHDRVVLITGASSGIGAAAARVFSQEGATVVLAARREDRLASLVAELKDKGARASY
VVCDVTVAEDAARAVDFTVDTYGRLDSAFNNAGLGGDRTPLHLMGDDVYDAVMDTNVRGV
WNCLRHEIAAMLQNPRGCSVVNNSSVGGLVAIPAAAPYIAAKHAVVGLTRAAADEYAQQG
IRVNAVAPGTTRSEITADWFGRNPGLEEMVNGMTPQGRTAEPEEIAQAAAWLLSDRCPFL
TGTVMPVDGGFVNQ
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcttctccatgacagagtcgtcctgatcaccggggcgagcagcggtatcggt
gcggcggcggcccgggtgttctcgcaggaaggcgcgacggtcgtcctggccgcccgccgg
gaggaccgactggcttcgctggtggcggagttgaaggacaagggggctcgggcctcctac
gtcgtctgtgacgtcacggtcgcggaggacgccgcgcgtgccgtcgacttcacggtcgac
acctacggccggctggactccgccttcaacaacgcgggcctgggaggcgaccggaccccc
ctccacctcatgggtgacgacgtctacgacgcggtcatggacaccaacgtgcgcggcgtc
tggaactgcctccgccacgagatagcggccatgctgcagaacccccgaggctgctccgtc
gtgaacaacagcagtgtgggcggcctggtggccataccggcggccgcgccctacatagcg
gccaagcacgccgtcgtgggcctcaccagggccgccgcggacgagtacgcccaacagggc
atcagggtcaacgccgttgcgccgggaaccacgcgcagcgagatcacggcggactggttc
gggcgcaatccgggcctggaggagatggtcaacggtatgaccccgcaggggcgtacggcg
gagcccgaggagatcgcccaggcggccgcctggctgctcagcgaccgctgtccgttcctc
acgggcacggtcatgccggtggacggcgggttcgtcaaccagtag

DBGET integrated database retrieval system