KEGG   Streptomyces formicae: KY5_6527c
Entry
KY5_6527c         CDS       T05416                                 

Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase
  KO
K13329  dTDP-4-dehydro-2,3,6-trideoxy-D-glucose 4-aminotransferase [EC:2.6.1.110]
Organism
sfk  Streptomyces formicae
Pathway
sfk00523  Polyketide sugar unit biosynthesis
sfk01100  Metabolic pathways
sfk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    KY5_6527c
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfk01007]
    KY5_6527c
Enzymes [BR:sfk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.110  dTDP-4-dehydro-2,3,6-trideoxy-D-glucose 4-aminotransferase
     KY5_6527c
Amino acid related enzymes [BR:sfk01007]
 Aminotransferase (transaminase)
  Others
   KY5_6527c
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: ATL31545
UniProt: A0A291QJC3
Position
complement(7606996..7608147)
AA seq 383 aa
MIHLHQPQVGQEELAAVAEVFDSKWLGHGPRTEAFEAAFAEHLQVDAEHVVFLNSGTAGL
FLAVESLDLTEGDEVVLPSPSFVAAANAVVAGGGRPVFCDVDPRTLNPTAEHIEAALTDR
TRAVLVLHYGGSPGDITRIAELCRHRDITLIEDAACSVASTVDGRPVGTFGDFAMWSFDA
MKVMVCGDGGMLYARDPDAAARARRLAYHGLAQPTGFGYAQVSSRWWELDVPEVGRRDIG
NDLTAAIGAVQLRRLPELVARRREITELYDRELADLADLSDLLTPPPLPAGHTSTYYFYW
VQMPPDIRDDVANELRAAGIYTTFRYAPLHKVPAYGAGELSLPGAEHAADRTLCLPLHPG
LDDADVHTVAAALRKSVEALLHR
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgatccatctccatcagccgcaggtgggccaggaggaactggctgccgtggccgaagtg
ttcgacagcaagtggctggggcacgggccccgtaccgaggcgttcgaggcggccttcgcc
gagcacctccaggtggacgccgagcacgtcgtcttcctcaactccggcaccgcggggctc
ttcctcgccgtcgaatccctcgacctgaccgagggcgacgaggtcgtcctgccctcgccc
agcttcgtcgccgccgccaacgccgtcgtcgccggcggcggccgcccggtcttctgcgac
gtagacccgcgcaccctcaaccccaccgccgagcacatcgaagcggccctcaccgaccgc
accagggccgtcctcgtcctgcactacggcggcagccccggcgacatcacccgcatcgcg
gaactctgccgccacagggacatcaccctgatcgaggacgccgcctgctcggtggcctcc
accgtcgacggccgacccgtgggcaccttcggcgacttcgccatgtggagcttcgacgcc
atgaaggtcatggtctgcggcgacggcggcatgctctacgcccgcgaccccgatgccgcc
gcgcgggccaggcgcctcgcctaccacggactggcacagccgaccgggttcggctacgcc
caggtctcctcacgctggtgggagctggacgtccccgaggtcggccgccgcgacatcggc
aacgacctcaccgccgccatcggcgccgtccaactgcgccgactgcccgaactggtcgcc
aggcgccgcgagatcaccgagctctacgaccgcgaactcgccgacctggccgacctgtcc
gacctgctgacgcccccgccgctgcccgcagggcacacctcgacgtactacttctactgg
gtccagatgcccccggacatacgcgacgacgtggccaacgaactgcgggccgcggggatc
tacaccacgttccgctacgcgccgctgcacaaggttcccgcctacggggcgggcgagttg
agcctgccgggggccgagcacgcggcggaccggaccctctgtctgcccctgcaccccggg
ctcgacgacgcggacgtgcacaccgtggccgccgccctgcgcaagtcggtggaggcactc
ctccaccgctga

DBGET integrated database retrieval system