KEGG   Shewanella frigidimarina: Sfri_2362
Entry
Sfri_2362         CDS       T00395                                 

Definition
(GenBank) ATPase AAA-2 domain protein
  KO
K11907  type VI secretion system protein VasG
Organism
sfr  Shewanella frigidimarina
Pathway
sfr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Sfri_2362
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfr02044]
    Sfri_2362
Secretion system [BR:sfr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Sfri_2362
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_16 ClpB_D2-small AAA_5 AAA_22 Sigma54_activat IstB_IS21 ATPase_2 TniB AAA_25 AAA_7 AAA_14 AAA_30 NACHT NTPase_1 AAA_18 ResIII DUF2075 Zeta_toxin Clp_N Hpr_kinase_C Rad17 T2SSE SRP54 ABC_tran_CTD DUF815 AAA_24 Cyclin_N CLZ Seryl_tRNA_N Not3
Other DBs
NCBI-ProteinID: ABI72207
UniProt: Q080V8
Position
complement(2812315..2814921)
AA seq 868 aa
MSAMTLSKLVGKLNPVCRQSLETAASVCHSRSQFSVEIEHWLLALLENGSGDLDIIMASF
SVQKDQLISDIRQGLEKFKTGNSAAPSLSPHIVSLLRQTWLNTSIEFNDSEIRTAYLIFT
LLTDDSLNSLVSCSAKQLLKIDPAQLKHAWPQLARQSTEHKVSSSDIEETQAMQSAPSKT
PNLDQFTQNLTEQAELGKIDPILGRDNEIRQMIDILTRRRQNNPILTGEAGVGKTAVVEG
LALKIAQKEVPTALQNVRIHVLDLALLQAGAGVKGEFENRLKALIKEVKQSVKPIILFID
EAHTMIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKFFEKDAALTRRFQVVKI
EEPSPEQAIAMMRGLLPVMEGHHKILVSDQALCAAVNLSHRYITGRQLPDKAVSLLDTAC
ARVAMSQASTPGMVESLQRQIQQLDTQISILTREQKTGSDHKKSITELTKKHKLLSKELA
PLTTQWQDELVTVQKIAELVGQIQASETDTAPLLVELTAFKAILSANKQPMVHWQVDEQL
VAEVISDWTGIPAGKMQDDEIKTILNLKDTMAKRVIGQDHALDLIAKTVQTSRAQLGDEK
RPIGVFLLTGPSGVGKTETALTLAEQVYGSEDNVTVINMSEFKEEHKVSLLLGSPPGYVG
YGEGGVLTEAVRRKPYSVILLDEMEKAHPGVQDIFYQVFDKGTIKDGEGRDIDFKNTIII
MTSNAGTETTMGLFEDEKIAPSIKGLRKALQDDLLSYFKPAFLGRLNVIPYIPLTQLMLN
EITKLQLQRVANRLAEHYQAKFTYSDDVVSQIVSMCQDAGSGARNVHNILQNTMLPDLSI
KILHNMANNKKTTNVKVNVVNDEFIYKI
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgtcagcgatgactttaagtaaattggtaggaaaacttaatccagtatgtcgacaatct
ttagaaaccgctgccagcgtatgccatagccgcagccaattcagcgttgagattgagcat
tggttattagcgttgctagagaatggttcgggtgatttagacatcatcatggccagtttt
tcagtacaaaaagatcagttgattagtgatatccgtcagggattagaaaagtttaaaaca
ggcaacagtgcagcaccaagcttgtcaccacatatagtaagtttgcttcgtcaaacttgg
ttaaataccagtattgaattcaacgatagtgagataagaactgcctatctgatttttacc
ttgctgactgacgattcattaaactctttggtttcgtgctctgcaaaacagctccttaaa
atagatcctgcacagctaaaacatgcatggccacagcttgctcgtcaatctaccgagcat
aaagtgtcaagtagcgatatcgaagaaactcaggcgatgcagtctgcgccgagcaaaaca
ccaaatctagaccaatttacccaaaatttaaccgagcaagcagaactggggaaaatagat
cctattcttggacgtgataatgaaattaggcagatgatcgacattttaacccgtcgccgt
caaaataatcctattttaacgggtgaagccggtgttggtaaaaccgctgttgtggaaggt
ttagcgcttaaaattgcccagaaagaagttccgactgcattacaaaatgttcgtattcat
gtactggatttagccttactacaagctggagccggagtgaaaggggaatttgagaaccgc
ttaaaagctttaattaaagaagttaaacagtctgttaaacctattattttatttatagat
gaagctcacaccatgattggcagcggcggacaagctggacaaaatgacgcggcaaattta
ttaaaacccgcattagcgcgtggtgagttacgtaccattgcggcaacaacatgggcagaa
tataaaaagttttttgaaaaagatgccgcattaactcgtcgttttcaagtggttaaaatt
gaagagccttctcctgaacaagctattgcaatgatgcggggcttgttacctgtaatggaa
gggcaccataaaattcttgtttccgatcaagctttatgtgctgcagttaacttatctcat
cgatatattactggccgacaactgccagataaagcggtaagtttattagatactgcatgc
gctcgtgttgctatgagtcaagcttctactcctggaatggttgaatcattacaacgacaa
attcagcaactagacacacaaattagcattctaactcgtgagcaaaaaacaggttcagat
cataaaaagtctattacagagttaaccaaaaaacataaattgctttcaaaagaactcgct
cctttgacaacacaatggcaggacgaattagttaccgttcaaaaaattgcagaattagtt
ggccagattcaagcatcagaaacagataccgcacctttgttagtggagttaacggcgttt
aaggcaatattgtcagccaataaacagcctatggtgcattggcaagttgatgaacaattg
gttgctgaagtcatttctgattggactggcattcctgcaggtaaaatgcaggatgatgaa
ataaaaacaattttgaacttaaaagacaccatggccaagcgcgttatcggccaagatcat
gccttagatttaatcgccaaaacagtgcaaacgtctcgtgcacagttgggtgatgaaaaa
cgtcccattggtgtatttttactgacaggccctagcggcgtaggtaaaacagaaacggca
ttaacattggctgagcaagtttatggtagcgaagataatgtaactgtcatcaacatgtct
gaatttaaagaagaacataaagtgtcattacttttaggttcacctccaggttatgttggt
tatggtgaaggtggagtgctgactgaagccgttcgccgtaaaccttatagtgttattttg
ctggatgaaatggaaaaggcacatccaggtgttcaagatattttttatcaagtttttgat
aaaggcaccattaaagatggtgaggggcgtgatatagatttcaaaaatactattatcatt
atgacctcaaatgctggtacagaaaccacgatgggcttatttgaagatgaaaaaattgcg
ccatcaattaaaggtttacgcaaagcacttcaagatgatttattgagttatttcaaaccg
gcttttttaggccgtttaaatgtaatcccttatattccgttgacccaactaatgctcaat
gaaatcactaaattgcaattacagcgagttgctaatcgtttagctgagcattatcaagct
aagttcacttacagtgatgatgtggtgagccaaattgtgtctatgtgtcaggatgctggt
tcaggtgctcgcaatgtgcataatattttacaaaatactatgttgcctgacctttcgatc
aaaatcttacacaatatggctaacaataagaaaacaaccaatgtaaaagtaaatgtagta
aacgatgagtttatttataaaatctaa

DBGET integrated database retrieval system