KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c22280
Entry
SGGBAA2069_c22280 CDS       T01444                                 
Name
(GenBank) FtsK/SpoIIIE family protein
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: FtsK_SpoIIIE HerA_C T2SSE RRM_9 AAA_22 DUF2162 AAA_19 nSTAND3 NACHT DUF87 EptA_B_N TatC
Other DBs
NCBI-ProteinID: CBZ49400
Position
complement(2280855..2282564)
AA seq 569 aa
MRLLPEYRGRRIRPYMRKLNVTLAFVFSFVLLLPAFAFSYVNIDALKAVDVKTIVILAVL
SVLAIVLGIWFSWFFREQTPFGKKVDRLGILSKYFFEHGFYYEKKRSGQNAKSKIRYPKI
YVKQRKYDLDISFEMAGNKFQDKFSKMGGELEKTLFMDFMETVDDVKYKTYTMAYQAFLN
RINVTDVMYEKGKGLLLMKNFYWDFDSDPHLLVAGGTGGGKTVLLQTLVLALAKIGVVDI
CDPKQADFVAIADMPAFKGRVAFDVEDIIQRFEKAEVIMMARYKFMNDERVRLKHKSLKK
YYEYGLEPYFISCDELNALMAMLDYKQRERLDKSLGNILFLGRQAGVFDISAMQKPSRED
LGSKLQANINMRLNVGRLDDGGYDIMYGEVNRNKDFKYLKYISGRRVYGRGYGAVMGDVA
REFFSPNMPKGFEFYDEFIKLERHENRFDPDENPEISVDIVNDKELLAVATEATNQANQI
SANKVQTEEIKYSLKEVADSIGASRPQVFKVVKMIEDDGYTTFEHDDTDKQVLTSSEVAL
VKELFDFKATNDLTWSNAVEQYFTKESED
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgcgattattgcctgaatatagagggcgacgaattcgtccgtatatgcgaaagctaaat
gtgactttagctttcgttttttcttttgtgttgttgttaccagcatttgcttttagttat
gttaatattgacgctttaaaagcagtagatgttaaaacaattgtgattttagctgtttta
agtgttttggcaattgttttaggtatttggttttcatggttttttagagaacaaacgcct
tttggtaagaaagttgaccgtttgggtattttatcaaaatatttttttgaacatggtttt
tattatgagaaaaagcggtcaggtcaaaatgcaaagtctaaaattaggtatccaaaaatt
tatgtaaaacaaagaaaatatgatttagatatttcttttgagatggctggaaacaagttt
caagataagttttcaaaaatgggtggtgagcttgaaaaaacgttgtttatggattttatg
gaaacagtagatgatgttaaatataagacttacactatggcttatcaagcttttcttaat
cgtattaatgttacagatgtaatgtatgaaaaaggaaaaggcttgttgctgatgaaaaat
ttttattgggattttgattcagacccacatttgcttgttgcaggtggaacaggaggcggg
aaaacggtccttttgcaaacattagttttagctttagctaaaattggtgtggttgatatt
tgtgaccctaagcaggctgattttgtagcgatagctgatatgccagcttttaaaggtcgt
gttgcttttgatgttgaagatattatacaacgttttgagaaagcagaagtaatcatgatg
gcacgttataaattcatgaatgatgaacgtgttcgattgaaacataagagtttaaaaaaa
tattatgaatatggcttagagccgtattttattagttgtgatgagcttaacgctttaatg
gcaatgttagattataaacaacgtgaacgattagataaatcacttggaaacattttgttt
ttaggtcgtcaagcgggggtttttgatatttctgctatgcaaaaaccaagtcgtgaagat
ttgggttctaaattgcaagcaaatattaatatgcgtttgaatgttgggcgtcttgatgac
ggaggctatgacattatgtatggtgaagttaatcgtaacaaagattttaaatatcttaaa
tatatttctggtcgtcgtgtttatggtcgtggatatggtgctgttatgggtgatgtggct
cgtgagtttttctcaccgaatatgcctaaaggatttgagttttatgatgagtttattaaa
ttagagcgtcatgaaaatcgttttgaccctgatgaaaatccagaaatttctgttgatatt
gttaacgataaagaacttttggcggttgccacagaagcgactaatcaggctaatcagata
tcggctaacaaagttcaaacagaagagattaaatatagcttaaaagaagttgctgatagt
attggtgcttctcgtccacaagtttttaaggttgtgaaaatgattgaagatgacggttat
acaacttttgagcatgatgatactgataaacaggtattaactagttcggaagtggcttta
gtgaaagaactctttgattttaaagcaacaaatgatttaacttggtctaatgctgtggag
cagtattttaccaaagaaagtgaagattag

DBGET integrated database retrieval system