KEGG   Sarcophilus harrisii (Tasmanian devil): 100924870
Entry
100924870         CDS       T02286                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:shr01002]
    100924870 (ADAMTS13)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100924870 (ADAMTS13)
Peptidases and inhibitors [BR:shr01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100924870 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Reprolysin ADAM_CR_2 ADAM_spacer1 Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_spondin TSP1_CCN Pep_M12B_propep Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 100924870
NCBI-ProteinID: XP_012409452
Ensembl: ENSSHAG00000006104
Position
2
AA seq 1592 aa
MTMICIWMIFVSVFFLLGSFQLPAFQERFLMALDPENFFFYFGAVSTLEAFEFDIFQLSC
LCEDRQISRPQCKSQRCSFQALGEPYAFHFPEELSLLIPSFTSQRVINSSLWELKQYPDN
CFTGGRVLLPPRAAAKITYCAGQLQGEVIVRGEQLYIQPLKREHWSLVPDYSHTNPHLIH
KTTQRASGALQAHRLYPRISKRALGSIKHLELLVVVGHDVYEYHKEDTERYILTNLNIGA
ELLRDISIGVPFRVHLIKMIILTEPEAGLNITTNLTSSLLSVCEWSQRINPPDDTHPHHA
DLVLYITRFDLELSDGNKQVRGVTQLGGACSSSWSCLITEDTGFDLGLTIAHEIGHSFGI
NHDGAEENSCSSNDHIMAPGGPPNSIGLTWSQCSREQFLHFISTGKASCVNDLPHLEAAI
PRAEPGLYYGAEEQCRVAFGSAAIACTFSRDDIDMCQVLSCHTDPGDQTSCSRILIPLLD
GTECGANKWCSKGHCRSLEELTPVSLVHGQWSSWGPPSTCSRTCGGGVITRRRHCNNPRP
AFGGRDCVGADLKAELCNTQACGKTQLEFMSEQCAATDGKPLYLTPGIPTYYSWKSAAQY
SQGNDLCKHTCWAAGKNFVVSRGESFLDGTRCVPTDHQAEGTTNLCVMGRCRAFGCDGGM
DSGYVKDVCQVCGGDNTTCSKVSGFYSGGKAQEYVTFLTIPPNFTTVHITNQKPLFTHLA
VKVRGQYVVSGKKSISFNTTYPSVLEDNQIEYKVFLTKDKMPHLEEIHIRGPTQEDIEVQ
VYRKYGNEYGNLTNPEITFSYFKPKQLQASVWAMVPGACSVSCGEGVRQVNYSCYDQAQD
KWTDDVYCAGIVKPLSWQELCTPGPCPPHWAAGDFGPCSTTCGEGVRERTVSCVKVEGNR
TLTLPESHCLASLQPPAAEACSPQLCLTRWKVSEPGPCSSACGLGLAQRNVTCVHEGDGL
EGPVDDGLCSVEEKPPHLLPCVVTVCPLGWNTQDSGSLLEQAMDQLGASWKENLTVHVWS
PLVGECSVSCGTGLRELRYVCLDFASRKEVQEEKCNPVNPPANQMMVCHAAACPPRWEVK
ALAPCPVTCGGGKVPLSVHCVRQNRGLTLSLPHSKCWGVPRPSSSRDCSPEPCPARWRHK
LASCNVSCGGGVVRRILYCARALGETGEEIVPDPQCQGLPRPEEQEPCNLDPCPPRWKIV
SSSSCSASCGLGMVTRTLACVQLDHGEEAEVEEGACATLERPPASIPCIVADCTYQWHFS
DWSECSASCGNGIQRRHDFCVRPYQSHTAVPAVFCQHIPKPVTVRGCSAGPCERRLVPKV
KAQQEATTARSLTAAAPALALQGPQDRALAVPRLFPPSSVRPEEPPEQEESTGTCGKQYL
KPAGTINMTGTQVAKCAVAIGRPLGEMVVFQVLESSLNCSVGEMLLFWGRLTWRKACKNL
AGVTFISKTNTLVVRQHLVFPENGVVLQYWSQLATENYHKECDMQLFGPRGEIVIPPRGQ
EVREQGGCRVFISVAPEARIAIHALNIDLGTEANQTSDSYILIHDMHNMKMVIFHGQQLF
YWESAGSQAEIEFSESFQKDHISFQGQYWILK
NT seq 4779 nt   +upstreamnt  +downstreamnt
atgaccatgatctgcatatggatgatctttgtttctgttttcttccttctgggatctttc
cagcttccagctttccaggagagatttttgatggctttggatccagaaaattttttcttt
tattttggtgctgtttctactctagaagccttcgagtttgatatatttcagctcagctgc
ctttgtgaagatcgccagatctccaggccgcaatgcaagtcccagcgctgctctttccag
gccctgggagaaccctatgccttccatttccctgaagagctcagcctcctgatcccatcc
tttactagccagcgggtgataaactcttctctctgggagctgaaacaatatccagacaac
tgcttcacaggaggaagggtcctattgccccctcgggctgctgctaaaattacttactgt
gcagggcagttgcaaggagaggtcattgtgaggggtgagcagctttacattcaacctctg
aagagagagcactggagcttggtaccagactacagtcataccaacccccaccttattcac
aagaccacccagagggcgtcaggggccctgcaagctcatagactttaccctcggatctca
aagcgggctctaggaagcatcaaacatctggagctactggttgtggtgggtcatgatgtc
tatgagtaccacaaggaagatacagagcgatatatcctcaccaacctcaatattggggca
gaactgctgagagatatttccataggagtcccattccgagttcacctgataaagatgatc
attctgactgagccagaggctggtctgaatatcaccaccaatctcacctcttcactgctc
agtgtgtgtgaatggagccagaggatcaatcccccagatgatacccacccacaccatgct
gacttggtcctctacatcacaaggtttgatctggagctgtcagatggcaacaagcaggtt
cggggggtgacccagctcgggggtgcttgctcctcctcctggagctgccttattacggaa
gataccggctttgatctggggctcaccattgctcatgagattgggcacagctttggtatt
aatcacgatggggctgaggaaaacagctgcagcagcaatgaccacatcatggcccctggt
ggccccccaaacagcatcggtctcacctggtcccagtgcagccgggagcaatttctccac
tttattagcacagggaaggcaagctgtgtgaatgacctgcctcacctggaagcggcgatc
ccccgcgcagagccgggcctctactacggggccgaggagcagtgcagagttgcctttggg
agtgccgcgattgcctgcaccttctccagggatgatattgatatgtgccaagtgctatcc
tgccatacagaccctggggaccaaaccagctgtagtcgcatccttatcccactcctggat
ggaacggaatgtggagccaataagtggtgctctaagggccactgccgttctctggaagag
ttgaccccagtgtccttggtacatggacagtggtctagttggggtcctcctagcacttgc
tcccgaacctgtggaggaggagtcatcaccagaaggcggcactgcaacaacccccgacct
gcctttggtggtcgtgactgcgtgggagccgatctcaaggctgaactgtgtaacactcag
gcctgtgggaagacacagctagagttcatgtctgagcaatgtgctgcgactgatgggaag
ccactttacctcactccagggatccccacctactatagctggaagtcagctgctcagtac
agccaaggaaatgatctgtgcaagcacacgtgctgggcagctggaaagaatttcgtagtg
agccgtggggaaagtttcctggatgggactcgctgtgtgcccacagatcaccaggcagag
gggaccacaaacctctgtgtgatgggcagatgcagggcatttggatgtgatggtggaatg
gattctggatatgtgaaggatgtgtgtcaggtctgtgggggagacaacaccacatgcagc
aaagtgagcggcttttactctggagggaaagcccaagaatatgtcacattcttgacaatt
cctcctaacttcaccactgtgcatatcaccaaccagaaacctctcttcacacacctggct
gtgaaggtaagaggacagtacgtggtctctgggaagaagagcatctcattcaacaccact
tatccctcggtcctggaagacaaccagattgagtacaaggtgttcctcaccaaggacaag
atgccccacctagaggagatccacatcagaggacccacccaagaggacattgaagtccag
gtttacaggaagtatggcaatgaatatggaaacctcaccaacccagagatcactttcagc
tacttcaagcctaagcagctgcaggcctccgtgtgggcaatggtacctggggcctgttca
gtaagctgtggggaaggagtgcgtcaggtgaattatagctgctatgaccaagcccaggac
aaatggactgatgatgtctactgtgcagggattgtgaagcccctatcatggcaggaactc
tgcacccctgggccgtgccccccacactgggcagcaggagactttggtccttgcagcacc
acctgtggggaaggagtgcgagagcggacagtaagctgtgtgaaggtggagggcaaccgt
accctgacgttaccggaatcccactgtctggcttctctccagccccctgctgctgaggcc
tgcagcccccagctctgccttaccaggtggaaggtgtcggaacccggtccatgctcgtct
gcctgtggtctgggtctagcccagaggaatgtgacgtgtgtgcatgaaggggatgggctg
gaaggcccggtggacgatgggctgtgctctgtggaagaaaagcctcctcatctcctgccc
tgtgtggtgactgtctgccccctgggctggaatactcaagattctgggtccctcttggaa
caagctatggaccaattgggagcttcctggaaggagaatctaacagtacatgtgtggagc
cctctggttggggaatgctcagtctcctgtggtacaggcttaagggagctacgctatgtt
tgtttggactttgccagcaggaaggaagtccaggaagagaaatgtaacccagtgaaccca
ccagcaaatcagatgatggtgtgccatgctgctgcctgtccacctaggtgggaggttaaa
gctctggccccttgtccagtgacctgcggaggggggaaagtgcccctctctgtccactgt
gtgaggcagaacagaggcctgactctcagccttcctcattccaagtgttggggggtgccc
cggcccagcagctcccgggactgcagcccagagccttgtcctgccaggtggcggcacaag
ctggcatcctgcaatgtaagctgtgggggaggagtggtccgcaggatcctctactgtgcc
agggctctcggggagaccggggaggagattgtgcccgacccccagtgccaggggctacct
cgcccagaggagcaggagccctgcaacctagacccttgcccacccaggtggaaaatagtg
tcgagcagctcatgctcagcgagctgtggtctgggcatggtcacgcgcaccctggcctgc
gtgcagctggatcatggagaagaagcagaggtggaggagggagcctgcgccaccttggag
aggcccccagctagcatcccttgcattgtagcagactgtacctaccaatggcatttcagc
gactggtcagagtgttccgcctcatgtgggaatgggatccagcgccgccatgatttctgc
gtcagaccctaccagtcccacactgcagtccctgccgtcttctgtcagcacatccccaag
cctgtgactgtgaggggctgctctgcggggccctgcgagaggcggctggtccccaaagtg
aaggcacagcaggaagccaccactgccaggagcctgacagcagcagctcctgctctagcc
ctccagggtcctcaggacagagccctggctgtcccccgcctcttcccaccttcatctgtt
cgacccgaggaacctcccgagcaggaagagagcactggtacttgtggaaagcaatacctt
aaacctgcagggactatcaatatgactggcacgcaggtggccaagtgtgcagtagccatt
ggtagacctttgggagagatggtggtcttccaagtcctggagagctccctcaactgcagt
gttggggagatgctgctgttttggggacggctcacctggaggaaagcctgcaagaatttg
gcaggggtgacattcatctccaaaaccaacaccctggtggtgagacagcacttggtattc
ccagaaaatggtgtggtgctgcagtactggagccagttagccacagaaaattatcacaaa
gaatgtgacatgcaactctttggtcctagaggagaaattgtgattcctccacggggccag
gaggtgagagagcaaggaggatgtcgagttttcatcagtgtggctccggaagctcggata
gccattcacgctctgaacattgatctggggacagaagccaatcagacatctgacagctac
attttgatccatgacatgcacaatatgaagatggtaatattccatgggcagcagttattc
tactgggagtcagcaggaagccaagctgaaattgagttcagtgagagcttccaaaaggac
cacatcagttttcagggtcaatattggatccttaaatag

DBGET integrated database retrieval system