KEGG   Sarcophilus harrisii (Tasmanian devil): 100931192
Entry
100931192         CDS       T02286                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100931192 (ANKRD53)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100931192 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 PHD_Oberon MCD
Other DBs
NCBI-GeneID: 100931192
NCBI-ProteinID: XP_031805590
Position
2
AA seq 646 aa
PFPSIPSSRLGKSFIAKKSLAQKPELLAASVGNLEWLHQCLKYQRDIRTDRKGFTALHLA
AQHCNLNCLTALVEQYRFPVNITTCKGWTPLHLAINKGDPGESLKCVQYLLKAGASVNAQ
NQNGTAPLHLASGEGMLDCIKVLVEAGGNVHITDNRQRKGLDLCKIWNHRDCARFLKDAM
WKQDKKELAEETYCLNQLKKKLLTMQKKYLFKKKKEKEAQNQVAFVQWLQTKPLPKIKIP
EPAQVREDWVKIKEAPPRGRKAIPPITKEPPRLRKELRRIREEPPVVPKEAPHIKKAAQA
LKPQPPRRPQPPRKRGSAVTPRVRRRFRPLKRVKPTLPAGFSSMAISSQQAPSGSRSSSS
LPTLGSPRPSTVPFSSGSAPSSSVGRSRESSRLQSISELSGRSRVTPTGSQQQFSSTRAP
SYSFLRSLCEASPEVEKPGPTDSGVRLPRDSLSLLNLYLAEIPQKPVPSPFSWRAKWNSS
TKLASRPVTQIAFPQGVRLGVQPDPQPHYNFRGFLKFFPNDEGRVLIQTATGDWIFPVPR
LPFQVLWRELCRRPQPDRLAGPEGPKNFSGHDLPVRHYVRENYLCSDFLAMSLRETFDAA
FIALVQRHRGFPSLPPASPSSLASSSSTSIALPQCLALLFSAPPLR
NT seq 1941 nt   +upstreamnt  +downstreamnt
cctttcccatccatccccagctcccgtctcggcaagagcttcatcgccaagaagtcgttg
gcgcagaagccggagctgctggcagcctccgtgggcaacttggagtggctgcatcagtgc
ctgaagtaccagagggacatccgcacggaccgcaagggcttcacggcccttcacctggcg
gcccagcactgtaacctgaattgcttgacggcgctggtggagcagtacaggttccccgtg
aacatcaccacgtgcaagggctggaccccccttcacctggccatcaataagggcgaccca
ggagagtccctcaagtgtgtccagtaccttttgaaggcgggagcctcggtcaatgcccaa
aatcaaaatggcacagccccgctgcacctggcgagcggggagggcatgctggactgcata
aaagtcctggtggaagctgggggcaacgtgcacatcaccgacaaccgtcagcggaaaggc
ctcgacctatgcaagatctggaaccaccgagattgtgcccggttcctgaaggacgccatg
tggaaacaggacaagaaagaactggctgaagagacgtattgcctgaaccagcttaaaaag
aaattgctgacgatgcagaaaaaatacctctttaaaaagaagaaagagaaggaagcccag
aaccaagtcgccttcgtccaatggctccaaacgaagcctctgccaaagattaaaatcccg
gagcctgcccaggtcagggaggactgggtcaagattaaggaggcacctcccaggggtagg
aaggcgatccctccgatcacgaaggagcctccccggcttaggaaggaactcaggcggatt
agggaggagcctcccgtggttcccaaggaggccccacacattaagaaggctgcccaggcc
ctgaagcctcagcccccgcggaggcctcagccaccccgcaagaggggctccgctgtgact
ccccgtgtccgcagaagattccgccccctgaagagagtcaagcctaccttgcccgccggc
ttctcctcaatggccatctcgagccagcaggccccctccggctcccgatcctcgtccagc
ctcccgaccctgggcagtccccggccctccacggtccccttctcgtccggctccgctccc
agctcctcagtgggccgctcccgagagtccagccggctccagtctatcagcgagttgtcc
ggccgctcccgggtcacccccaccggctcccagcagcaattctcgtccactcgggcgccg
tcttactcgttcttgcggagcctctgcgaggcttccccggaggtcgagaagcctgggccc
acggactcgggcgtccgcctgccgcgggactcactgtccctgctcaacctgtacctggcg
gaaatcccccagaaacccgtgccctcgcccttctcctggagggccaagtggaactcaagc
accaagctcgcgtcgaggcccgtcacccagatcgccttcccacagggcgtgcgcctgggg
gtgcagcccgacccccagccccactacaacttccgcggtttcctcaagttcttccccaac
gacgagggcagggtgctcatccagacggccacaggcgactggatcttcccagtgccccgg
ctgcccttccaggtcctgtggcgggagctgtgccggcggccgcagcctgaccgcctggcg
gggcccgaggggcccaagaacttctccggccatgacctgcccgtcaggcactacgtccgt
gaaaactacctctgctcggacttcctggccatgagcctccgggaaacctttgacgcggcc
ttcatcgccttggtgcagagacaccggggcttcccttccctccctcccgcctcccccagc
tccctggcttcctcctcctccacctcgatcgctctcccgcaatgcttggctctcctgttc
tcagctccccccctccgataa

DBGET integrated database retrieval system