KEGG   Shewanella sp. W3-18-1: Sputw3181_2457
Entry
Sputw3181_2457    CDS       T00453                                 
Name
(GenBank) bacteriophage lambda tail assembly I
Organism
shw  Shewanella sp. W3-18-1
SSDB
Motif
Pfam: Lambda_tail_I CRT-like CoV_NSP4_N DUF2169
Other DBs
NCBI-ProteinID: ABM25281
UniProt: A0A6N3J5T1
Position
complement(2839301..2839951)
AA seq 216 aa
MNSQQLTTIKLSGSLAKKFGREHKRFLDTGTTTEAFSALKNTLQGFEGFIKEQAKLGLRY
AIFRNGKNTGEDEFDLAGTREIRIVPVIGGSKRAGVMQTIIGAVLIVVGVFTTIFGDYSG
SVIQVGVAMVAGGVVQMLSPQAKGLKGSEAAENAPSYAFGGAVNTTAAGNPVGIGYGKRR
IGGAIISAGIYAEDIATSQRPIQSGGSNGGGSQQEQ
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaactcacaacaactcaccacgataaaactatcaggatcgcttgctaaaaagtttggc
cgtgagcataagcgatttttagatacaggcaccacaactgaagcgtttagcgcccttaaa
aataccctgcaaggttttgaagggtttattaaggagcaagcaaaacttgggttgcgttac
gctatttttcgtaatggtaaaaacacaggcgaagatgaatttgatttagccggcactcgc
gagatcaggattgtgcctgttattggtggcagtaagcgagcaggagtaatgcaaactatt
attggcgctgttcttattgtcgttggcgtttttacaacaatattcggcgactatagcggt
tctgtaattcaggttggtgtggcaatggtcgccggcggcgtggtgcaaatgctgtcaccg
caagctaaggggttaaagggcagtgaggcggcggagaacgcgccaagctatgcctttggt
ggcgcggtcaacaccacggcagcgggtaatcctgttggcattggttacggcaagcgccgc
atcggtggtgcaattattagtgctggcatttatgcagaagacattgcaacaagccagcgc
ccaattcaatccggtggcagtaatggcggcggcagtcaacaggagcaataa

DBGET integrated database retrieval system