KEGG   Ruegeria pomeroyi: SPO0030
Entry
SPO0030           CDS       T00215                                 

Definition
(GenBank) voltage-gated sodium channel
  KO
K08714  voltage-gated sodium channel
Organism
sil  Ruegeria pomeroyi
Brite
KEGG Orthology (KO) [BR:sil00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sil02000]
    SPO0030
Transporters [BR:sil02000]
 Other transporters
  Pores ion channels [TC:1]
   SPO0030
SSDB
Motif
Pfam: Ion_trans PKD_channel DUF2973
Other DBs
NCBI-ProteinID: AAV93361
UniProt: F7IVA8
Position
30727..31503
AA seq 258 aa
MQRMQAFIDRPGFGRFITAVIMLNAVVLGMETSPYLMERWGGLILAADRICLGIFIVEIA
LKLTAQRQRFFLNGWNLFDFVIVGIALIPAAGGLSVLRALRILRVLRVISVAPRLRRVVE
GFITALPGMASVFLLMTIIFYIGAVIATKLFAASFPDWFGDLGLSAYTLFQIMTLESWSM
GIVRPVMQVYPYAWLFFVPFIMITTFAVVNLLVGLIVNSMQDAHHAEDGERTDAYRDEVL
ARLEQIDQRLNALGETKK
NT seq 777 nt   +upstreamnt  +downstreamnt
atgcaaagaatgcaggcctttatcgaccggcccggtttcggccggttcattaccgccgtg
atcatgctgaacgccgtcgtgctggggatggagacgtcgccctatctgatggagcggtgg
ggcgggctgatcctggccgctgaccgtatctgcctaggcatcttcatcgtcgagatcgcg
ctgaaactgacggcgcagcggcagcgctttttcctgaacggctggaacctgttcgatttc
gtgatcgtcgggatcgccctgatccccgccgccgggggtctgtcggtgctgcgggcgctg
cgcatcctgcgggtgcttcgcgtgatctcggtcgcgccgcgcttgcgccgcgtggtcgaa
ggcttcatcactgcgctgcccggcatggccagcgtgtttctgttgatgaccatcatcttc
tacatcggcgcggtgatcgcgaccaagctgttcgccgcctcctttcccgactggttcggc
gatctgggtctgtcggcctatacgctgttccagatcatgacgctggaaagctggtcgatg
ggcatcgttcgcccggtgatgcaggtctatccctatgcctggctgttctttgtccccttc
atcatgatcaccacatttgcggtggttaacctgctggtcggtctgatcgtgaactcgatg
caggacgctcatcacgccgaggatggcgagcggaccgatgcctatcgggacgaggttctg
gcccgcctggaacagatcgaccagcggctgaatgcgcttggtgaaaccaaaaagtga

DBGET integrated database retrieval system