KEGG   Simplicispira suum: C6571_12655Help
Entry
C6571_12655       CDS       T05361                                 

Gene name
ribB
Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
simp  Simplicispira suum
Pathway
simp00740  Riboflavin metabolism
simp00790  Folate biosynthesis
simp01100  Metabolic pathways
simp01110  Biosynthesis of secondary metabolites
Module
simp_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:simp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    C6571_12655 (ribB)
   00790 Folate biosynthesis
    C6571_12655 (ribB)
Enzymes [BR:simp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     C6571_12655 (ribB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     C6571_12655 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AVO42019
UniProt: A0A2S0N1J9
Position
complement(2723277..2724407)
Genome map
AA seq 376 aa AA seqDB search
MNAPLPGSAIAPISPVQDIVEEMRAGRMVILVDEEDRENEGDLVLAADHVTPEAINFMAR
FGRGLICLTLTRERCERLRLPPMATRNGTKMGTAFTVSIEAAEGVTTGISAADRARTVQA
AVAAQAQADDLVQPGHIFPLQAVDGGVLMRAGHTEAGCDLAAMAGCSPAAVICEIMKDDG
TMARLPDLQLFAAEHGIKIGTIADLIEHRSRTESLVQKVGTRSMQTAFGEFTAHAFRDGP
SQAVHIALVRGQWQEGESVPVRVHEPLSVLDTLEVNRAMHSWGLDTSLQYIASQGRGVAV
LLNCGESAEQLLAQFDGTARAAHAPERGRMDLRTYGVGAQILRECGVVRMQLMGQPRRMP
SMAGYGLEITGYIPKE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccccccttcctggctcagccatcgcaccgatctctccggtgcaagacatcgtc
gaagaaatgcgcgccgggcgcatggtgatcctggtcgatgaagaagaccgcgagaacgaa
ggcgacctggtgctggccgccgaccacgtcacgccggaggccatcaacttcatggcccgc
tttggccgtggcctgatctgcctgacgctcacccgcgagcgctgcgagcgcctgcgcctg
ccgcccatggcgacacgcaacggaacaaaaatgggaacggctttcaccgtctctatcgaa
gcggccgaaggggtgaccaccggcatttcggcggccgaccgcgcgcgcaccgtgcaggcc
gccgtggctgcccaggcgcaggccgacgatctggtgcaacccggccatatctttccgctg
caagccgtggatggcggcgtactgatgcgcgcgggccataccgaagccggctgcgacctg
gccgcgatggccggctgcagcccggccgccgtgatctgcgagatcatgaaagacgacggc
accatggcccgcctgccggatctgcagttgtttgctgccgagcacggcatcaagatcggc
acgattgccgacctcatcgaacaccgaagccgcaccgaatcgctggtgcaaaaagtcggc
acgcgcagcatgcagaccgcctttggcgagttcaccgcccatgccttccgcgatggcccg
agccaggctgtgcacatcgcgctggtgcgcggccagtggcaggagggcgaatcggtcccg
gtgcgcgtgcacgagccgctgtcggtgctcgacacgctggaggtgaaccgcgccatgcac
tcctggggactggacaccagtctgcagtacatcgccagccaggggcgcggcgtggccgtt
ctgctcaattgcggtgagagcgccgagcagctgctggcccagttcgatggcacggcccgc
gccgcccacgcgcccgagcgcggacgcatggatctgcgcacctacggcgtaggcgcccag
atcctgcgcgaatgcggcgtcgtgcgcatgcagctcatgggccagccgcgccgcatgccc
agcatggcgggctacggactcgaaatcaccggttacatcccaaaagaatag

DBGET integrated database retrieval system