KEGG   Sphingobium indicum UT26S: SJA_P1-01750
Entry
SJA_P1-01750      CDS       T01201                                 
Symbol
trbE
Name
(GenBank) conjugal transfer protein TrbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
sjp  Sphingobium indicum UT26S
Pathway
sjp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SJA_P1-01750 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_P1-01750 (trbE)
Enzymes [BR:sjp01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     SJA_P1-01750 (trbE)
Secretion system [BR:sjp02044]
 Type IV secretion system
  Trb secretion system protein
   SJA_P1-01750 (trbE)
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 TraG-D_C AAA_29 FtsK_SpoIIIE ABC_tran DUF87 AAA_16
Other DBs
NCBI-ProteinID: BAI99127
NITE: SJA_P1-01750
UniProt: D4Z945
Position
pCHQ1:complement(143396..145834)
AA seq 812 aa
MMNLAEYRNRNTRLADFLPWVALAGEGVILNKDGSFQRTARFRGPDLDSAVPAELVAVAG
RLNNAFRRLGSGWAIFVEAQRHEAATYPTSRFPDPASALVDAERKADFEEAGAHFESSYF
LTFLYLPPAEDAARAESWLYEGRERGGVDAHEVLRGFIDRTDRILQLVDAFMPECAWLDD
AETLTYLHSTVSTTRHRVRVPETPMYLDALVADQPLTGGLEPRLADTHLRILTIVGFPTA
TTPGILDELNRLAFPYRWSTRAVLLDKTDATKLLTKIRRQWFAKRKSIAAILKEVMTNEA
SVLVDTDAANKAADADLALQELGADYAGQAYVTATITVWDADPRIAAEKLRLVEKVIQGR
DFTAMPETINAADAWLGSLPGHVYANVRQPPLSTLNLAHMIPLSAVWAGPERDGHFAAPP
LLFGKTEGSTPFRLSIHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYDRAQVFAFDFGG
SIRAAALAMGGDWHDLGGGLTEGADDSVSLQPLARIDDAAERAWAADWISAILSRESVAI
TPEVKEHIWSALTSLASAPPAERTLTGLSVLLQSNDLKQALRPYCVGGPYGRLLDAEAEH
LGEATVQAFETEGLIGTGAAAAVLAYLFHRIEDRLDGRATLIIIDEGWLALDDEGFAGQL
REWLKTLRKKNASVIFATQSLSDIDGSAIAPAIIESCQTRILLPNERAIEPQITAIYRRF
GLNDRQIEILARAMPKRDYYCQSRRGNRLFELGLSDVALALCAASSKSDQAAIASTVAEH
GRDGFLTAWLDRHDLGWAAQLIPNLETLETSS
NT seq 2439 nt   +upstreamnt  +downstreamnt
atgatgaaccttgcggaatatcgcaatcgcaacacccggctcgccgacttcctgccctgg
gtcgcgctcgccggcgagggcgtgatcctgaacaaggacggcagcttccagcggaccgcc
cgcttccgcggtccggacctcgacagcgccgtgccggccgaacttgtcgcggtcgccggc
cgcctcaacaacgccttccgccgcctcggctcgggctgggcgatcttcgtcgaggcgcag
cgccatgaggccgcgacctatccgacaagccgctttcccgacccggcatcggccttggtc
gacgccgagcgcaaggccgacttcgaggaggccggcgcgcatttcgagtccagctatttc
ctgaccttcctctatctgccgccggcggaagacgccgcccgcgccgaaagctggctctat
gagggccgcgagcgcggcggcgtcgatgcccatgaggtgctgcgcggctttatcgaccgc
acggaccgcatcctccagctcgtcgacgccttcatgccggaatgcgcctggctcgatgac
gctgagacgctgacctatctgcactccacggtctcgacgacgcggcaccgcgtccgcgtg
cccgagacgccgatgtatctcgacgctctcgtcgccgatcagccgctcaccggcgggctc
gaaccgcgcctggccgacacgcatctgcgcatcctcaccatcgtcggatttccgaccgcg
acgacacccggcatcctcgacgaactcaaccggctcgccttcccgtatcgctggtcgacc
cgcgccgtgctgctcgacaagaccgacgcgaccaagctgctgaccaagatccgtcggcag
tggttcgccaagcgcaaatcgattgccgccatcctgaaggaggtgatgaccaacgaggcg
tcggtgctggtcgacaccgacgccgcgaacaaggcggcggacgcggatctcgcgctgcag
gagctcggcgccgactatgccggccaggcctacgtcaccgcgacgatcaccgtctgggac
gccgatccgcgcatcgccgccgagaagctgcgcctcgtcgagaaggtcatccagggccgc
gacttcaccgccatgcccgagacgatcaacgccgccgacgcctggctcgggagcctgccg
gggcatgtctatgccaatgtccgccaaccgccgctttcgaccctcaacctcgcccatatg
atcccgctgtcggcggtgtgggccgggcccgagcgcgacgggcatttcgcagcgccgccg
ctgctcttcggcaagaccgaaggctcgaccccattccggctgtccatccatgtcggcgac
gtcggccacaccctcgtcgtcggtccgaccggggccggcaagtccgtgctgctggcgctc
atggcgctgcaattccgtcgctacgatcgcgcccaggtcttcgccttcgatttcgggggc
tcgatccgcgccgcggcgctcgccatgggcggcgactggcatgatctcggcggcgggctg
accgagggtgcggacgacagcgtctcgcttcagccgctcgcccggatcgatgacgccgca
gaacgcgcctgggccgccgactggatctccgccatcctcagccgcgagagcgttgcgatc
accccggaggtcaaggagcatatctggtcggcgctgacatcgctggcttcggcgccgccc
gccgagcgcaccctgaccggcctgtcggtgctgctccagtccaacgacctcaagcaggcg
ctacggccctattgcgtcggcggaccctatggccggctgctcgatgccgaggccgagcat
ctcggcgaggccaccgtccaggctttcgaaaccgaaggactgatcgggaccggggccgca
gccgccgtgctcgcctatctcttccaccggatcgaagatcgcctcgacggccgcgccaca
ctcatcatcatcgacgagggctggctcgcgctcgacgacgagggcttcgccggccagctc
cgtgagtggctgaagacgctgcgcaagaagaacgcgtcggtcatcttcgctacccagtcg
ctttccgacatcgacgggtcggccatcgcgcccgctatcatcgagagctgccagacccgc
atcctgctccccaacgagcgcgccatcgagccgcagatcactgccatctaccgacggttc
gggctcaacgaccggcagatcgagatcctcgcccgggcgatgccgaagcgcgactattat
tgccagtcgcgccggggcaatcgcctcttcgagctgggcctgtcggacgtcgcgctggcg
ctctgcgccgcgtcctccaagtccgatcaggcagcgatcgccagtacggtcgccgagcat
ggccgcgacggcttcctcaccgcctggctcgatcgccacgatctcggctgggcggcccaa
ctcatccccaacctcgaaactctggagacctcctcatga

DBGET integrated database retrieval system