KEGG   Saccoglossus kowalevskii (acorn worm): 100313758Help
Entry
100313758         CDS       T04123                                 

Definition
(RefSeq) Trk-like protein receptor kinase
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Brite
KEGG Orthology (KO) [BR:sko00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sko01001]
    100313758
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100313758
Protein kinases [BR:sko01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   100313758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr LRR_8 Pkinase LRR_4 LRR_5 LRR_9 fn3 Kinase-like B2
Motif
Other DBs
NCBI-GeneID: 100313758
NCBI-ProteinID: NP_001161675
UniProt: D1LXG8
Position
Un
AA seq 768 aa AA seqDB search
MTTLIILLFITLTFTTPASVIATWCMDLPRGCQCGARDAVTCRGYFTRIPTNLPSQIHEL
ILQHNEITEIGSSDLEQLRQLKVLDLSNNRINKIGQNVFLTLENLESLNLERNHINWLDS
RAFRGLQRLRHLYLDHNNIGILPMGLFAEMSYLHELRLNNNGLHDVPKHTADELSKTIVK
LVTLDHNPLHCSCDLLLFSHWLKQSTDVILLKPDSVRCTTDNEIDKYKVVDLVEDDVMCA
PSLAPKILDIETISCDSVRISWDYPMSYTRSKAQTKASISFDTVIKKGPLFNVMVKVTDT
HEASRMPHVFMESDETAVINGLDASIEHQFTVQAMNEVGRGPFSDVRKYRISIFKSGEQV
VSCLEEPEEETDVDQPPHKTLIDETIREEKDKRMIIITVSCLTGAVVVAIVLAVFFVKVY
QPRRNGFAPFSSVKFSKCEMPPMTYDDEVTSSSVESVDKYRNYTTTMIEGLPTVRILTET
PRDTVHFIREIYCGRFGRIYEAVVTELLPTEKQTVTMVKELRENATEHARQSFDGQVSTL
CEFEHPNVLEMLGVVTIGEPLSIIYEYADCGDLKEFLNCNSPFNKTKSATNSLILSQDKL
VDVATQVACAMSYLSASGFVHRDLAAHNCMVSSDLTVKVADIGISKERYPMHYMRVGRKL
LPVRWMAPETLESTTHFNAETDVWSYGVTLWEIFSYGTLPFSCFTDDQAVSHTLRGTLLP
ISDCLPKKVCDVMMACWRNNAHERASFNDIHGSLSSCRLSDCEGEIRV
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctgataatcttgttgtttattacgctaactttcaccactcctgcctcggtc
attgcgacgtggtgtatggaccttcctcggggatgtcaatgtggcgcacgagacgctgtc
acatgtagaggctatttcacacgtatacccaccaatctgccttcacagatacacgaacta
atactgcagcataatgaaatcacagaaatcggctcatcggatttagaacaattacgtcaa
ctgaaagtacttgatctgagtaacaaccgaataaacaagattggacagaatgtgttctta
acgctagaaaacttggaatcactaaatttagaaagaaatcatattaattggctggatagc
agggcatttcgcggcctgcagagactacgtcacctttacctggaccacaacaacatagga
atacttccaatgggcctatttgctgagatgtcgtatctacatgaactgcgcttgaataat
aatggtctccacgatgttcccaagcatacagcagatgaattatcgaaaacaattgtcaaa
cttgtgacactagaccataacccattgcactgtagctgtgatttgttgctgttttctcat
tggttgaaacaaagtacagacgtcatactactaaaaccagactctgttcggtgtacgacg
gacaacgaaatcgacaagtacaaagtcgtagacctcgtggaggatgatgtgatgtgtgct
ccatcattagctccaaaaatattggacattgaaacaatatcctgtgacagtgttcgaata
agctgggactatccaatgtcttacactcgcagcaaagcgcagacgaaggcgtcgatctcg
ttcgatacagttatcaaaaaaggtccacttttcaatgtgatggtgaaagtgacagataca
cacgaagcatcgcgtatgccacacgtgtttatggaaagcgacgagaccgctgttatcaac
ggattagacgcatcgattgaacatcagtttaccgtacaagccatgaacgaggttggacga
ggaccatttagtgatgtcagaaaatacagaatttcaatttttaaatcaggggaacaggtg
gtttcttgtcttgaggaacccgaggaagaaactgatgtagatcaaccacctcacaaaaca
ctgatagatgaaacgattcgggaagaaaaggataagcgaatgattatcatcactgtatcc
tgccttactggagcagtcgtcgtggctattgtccttgcagtattctttgtgaaagtgtat
caaccacgtaggaatggtttcgctccattttcgtcagtcaaattcagtaaatgtgaaatg
ccgcctatgacgtatgacgacgaggtgacgtcatcgtcagtcgaaagtgtggacaagtat
aggaactatacgactacgatgattgaagggctacccaccgtgcgaattctgactgagact
ccgagagacactgtgcacttcattcgtgagatatactgcggcaggttcggacgaatctac
gaagcggtggtcaccgaactgcttcccactgaaaaacagacggtaaccatggtgaaagaa
ctacgagaaaatgccactgagcatgcgcgacaatcgttcgatggacaagtctcgacgttg
tgtgagtttgaacatccaaacgtactggaaatgctcggagttgtcacaataggtgaaccg
ctgtcgattatctatgaatatgccgactgtggcgacctgaaagagtttttgaactgcaac
tctcctttcaacaaaacgaagagcgccaccaactcattgatcctttctcaagacaaactt
gtcgatgtggccactcaagtggcctgtgccatgtcgtatctgtcggccagtgggtttgtc
caccgcgatttagcggctcataattgcatggtgtccagtgacttaacagtgaaagttgcc
gatataggaatttccaaagaacgatatccaatgcattacatgagggttggtcgcaaacta
ttacctgtacggtggatggcacccgaaacactggagagtactacgcacttcaacgcagag
accgacgtctggtcatacggtgtaacgctctgggaaatattttcatacggaacactaccg
ttctcgtgcttcactgacgatcaggccgtctcgcacacactcaggggtaccctacttcca
atttctgactgtctaccaaagaaggtctgtgacgtcatgatggcttgttggaggaacaat
gcacacgagagggcgtcttttaatgatatccacggcagcctatcaagctgccgactgtca
gactgtgagggcgaaatccgtgtttga

DBGET integrated database retrieval system