KEGG   Spirosoma linguale: Slin_6212Help
Entry
Slin_6212         CDS       T01156                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sli  Spirosoma linguale
Pathway
sli00520  Amino sugar and nucleotide sugar metabolism
sli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Slin_6212
Enzymes [BR:sli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Slin_6212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 8729995
NCBI-ProteinID: ADB42171
UniProt: D2QTN9
Position
complement(7529870..7531066)
Genome map
AA seq 398 aa AA seqDB search
MMPLDQNTTPLVLSGIHYQTHEPVDVMVASGIITDIQKREQAPDETLPFIGPGLVDMQVN
GFAGVDFNDATLTVDGVIAITQSLLKLGVTTFYPTVITNADDTIRTILQTIHQACETSSL
VASCIGGIHLEGPFISPEEGPLGAHPKAHVKPPDWSLLQSFIDASGGRIRLITLSPEWPG
SADFIRQCVEHGLLVAIGHTAASPAQIQEAVDAGARLSTHLGNAAHQLLPRHPNYIWEQL
AQDGLAASVIADGFHLPPSVLKVIFRMKAEKAILISDSVSLGGLPAGNYQSPVGGEVTLT
DEGKLHLAGKPTVLAGSAQPLLWGVNQVVRLGLASLDKAWEMASIHPSRLLNLPQQGGLT
IGAPADLVLFRAVEVIKVYKKGCDTEIRRDCTEIHREK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgctggaccaaaacacgaccccgctggttctgtccgggattcattaccaaacc
catgaaccggtcgatgtcatggtggcgtcgggtatcattacggacattcagaaacgggaa
caggctcctgacgaaaccttaccattcatcggtcccggactggtggatatgcaggtgaac
gggttcgcaggcgtcgactttaacgatgcgacattgacggtggatggggtcatagcgatt
acccaatcgctgctgaaacttggcgtcacgacgttttaccctaccgttatcaccaatgcc
gacgatacgattcggacgattctacaaaccattcatcaggcttgcgaaacgtcttcgctg
gtggcgtcctgcatcggtggtattcatctggaagggccgttcatctcgcccgaggaaggc
ccgctcggtgcgcatcccaaagcccacgtcaaaccgcccgactggtcgttgctacaatcc
ttcatcgacgcatcgggcggtcgtattcgcctgattacgctgtcaccggaatggcccggc
tcggctgattttatccggcaatgcgtcgaacacggcttgctggtggccattgggcacacg
gcggccagtccggcgcagattcaggaagcggtcgacgcgggagcgcgtttatcgacacac
ctcggtaatgccgcccatcagcttttgccccgccacccgaattacatctgggagcaactg
gcgcaggatgggctggcagcttcggtgattgcggatgggtttcatttgccgccttccgta
ctaaaagttatcttccgcatgaaagcagaaaaagccattctgatcagcgacagcgtcagt
ctgggcggcttacccgccggaaactaccagtcgccggttggcggagaggttacgctgacc
gacgaaggcaagctgcatctggcgggtaaaccaacggtgctggcgggatcggcgcaacca
cttttgtggggtgtcaatcaggtggttcgcctagggttagcttctttggataaagcttgg
gaaatggcatccatccaccccagccgactactaaacctgccccaacagggcggtcttacc
attggtgcaccagcagacttggtgttattccgggctgttgaggttattaaagtatataaa
aaaggttgtgacacagagatacgcagagattgcacggagatacacagagaaaaataa

DBGET integrated database retrieval system