KEGG   Streptomyces avermitilis: SAVERM_1349
Entry
SAVERM_1349       CDS       T00126                                 

Gene name
adc
Definition
(GenBank) putative acetoacetate decarboxylase
  KO
K01574  acetoacetate decarboxylase [EC:4.1.1.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00072  Synthesis and degradation of ketone bodies
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_1349 (adc)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SAVERM_1349 (adc)
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.4  acetoacetate decarboxylase
     SAVERM_1349 (adc)
SSDB
Motif
Pfam: ADC DUF1408
Other DBs
NCBI-ProteinID: BAC69059
NITE: SAV1349
UniProt: Q82NF4
Position
complement(1663815..1664570)
AA seq 251 aa
MNQQDVPRHFATPLANPAYPPVVPRFTNREYLNIVYRTDHEALRAVVPEPLEIDEPLVRF
EVMRMGDVSGYGPYTESGQAIPVTYQGERGEYLHAMYLDNLPAITSGREASAYPKTAGSP
GLYAEHGALVGVLDVGTLRVATATMGYKHYELSVEEAVAQVGVPTYMLKLVPGFDGAPQV
AQLVRNEITDITVKGAWTGPARLQLFQHVLAPLADLPVREVISASHILTDLTLAPVKPVH
DYLAHPAYPTR
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaatcagcaggacgtgccccggcacttcgcgacgccgctggccaacccggcctatccg
ccggtcgtgccgcggttcaccaaccgcgagtacctcaacatcgtctaccgcaccgaccac
gaggccctgcgcgcggtggtgccggaaccgttggagatcgacgaaccgctggtgcgcttc
gaggtcatgcggatgggcgacgtcagcgggtacggcccgtacaccgagtcgggccaggcg
atcccggtcacctaccagggggagcggggcgagtacctgcacgccatgtacctggacaac
cttccggccatcacctccggccgcgaggccagtgcctaccccaagaccgccggctcgccc
ggcctctacgccgaacacggcgcgctggtcggcgtcctcgacgtcggcacgctccgggtg
gcgaccgccaccatgggctacaagcactacgagttgtcggtcgaggaggccgtggcccag
gtcggtgtgccgacctacatgctcaagctggtccccggcttcgacggggcgccgcaggtc
gcgcagttggtgcgcaacgagatcaccgacatcacggtgaagggtgcctggaccggcccc
gcccggcttcagctgttccagcacgtgctggcgccgctggccgatctgccggtgcgcgag
gtcatctccgccagccacatcctcaccgatctgaccctcgcgccggtcaagccggtccac
gactacctggcccaccccgcgtaccccacgcggtga

DBGET integrated database retrieval system