KEGG   Streptomyces avermitilis: SAVERM_1381
Entry
SAVERM_1381       CDS       T00126                                 

Gene name
fadE15
Definition
(GenBank) putative acyl-CoA dehydrogenase
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_1381 (fadE15)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_1381 (fadE15)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     SAVERM_1381 (fadE15)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_dh_N TPR_9 HpaB_N
Other DBs
NCBI-ProteinID: BAC69091
NITE: SAV1381
UniProt: Q82NC2
Position
complement(1698729..1699994)
AA seq 421 aa
MSLFEMSDRAKKYQAELLEFMDSHVYPAEAVYHEQMSASGDPHFHPPVIEELKAEARGRG
LWNLFHPHPEWGPGLTNLEYAPLAEIMGRSHIASEACNCNAPDTGNMEVLTLFGSDEHKE
KYLKPLLDGTMASAFAMTEPRVASSDATNIELRMERDGDEYVLNGRKWFASNALHRNCKV
LIVMGKTDPTADPHRQQSMMVVPIDAPGVTVMRGLLVFGYQDREGHAEIDFTDVRVPAKD
VLKGEGEGFAISQARLGPGRIHHCMRAIGAAERALELMCRRAQSRVTFGSPVAERSNIQD
WIAEARIDIEMIRLLTFKAAYLMDTVGNKGARTEIAAIKVAAPNIALKIIDRAIQVHGAA
GVSEDFPLAMMYAQLRTLRLADGPDEVHKRAIARHELGRYRDAAGAAGGTVTPGGHKAVV
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtccctgttcgagatgtcggaccgcgccaagaaataccaggcggaactgctcgagttc
atggattcgcatgtctaccccgctgaggcggtgtaccacgagcagatgagcgcttcgggt
gacccgcacttccaccccccggtcatcgaggagctcaaggcggaggcgcggggacgcgga
ctgtggaacctcttccacccgcacccggaatggggccccgggctgacgaacctcgaatac
gcgccgctggcggagatcatggggcgcagccacatcgcctccgaagcgtgcaactgcaat
gctcccgacaccggcaacatggaggtgctcacgctgttcggcagcgacgagcacaaggag
aagtacctcaagcccctgctcgacgggacgatggcctcggccttcgcgatgaccgagccg
cgtgtcgccagctccgacgccaccaacatcgagttgcggatggagcgcgacggcgacgag
tacgtactcaacggccgcaagtggttcgcgtccaacgccctgcaccgcaactgcaaagtg
ctcatcgtcatggggaagacggaccccaccgctgatccgcaccgccagcagtcgatgatg
gtcgtcccgatcgacgcccccggggtcacggtgatgcgcggcctgctggtgttcggctac
caggaccgtgaggggcacgccgaaatcgacttcaccgacgtacgggtgccggccaaggac
gtcctcaagggcgagggagagggcttcgcgatcagccaggcccggctcgggcccggtcgt
atccaccactgcatgcgggccatcggcgcggccgagcgggcgctggagctgatgtgccga
cgcgcgcagtcacgggtgacattcggcagtccggtcgccgagcggtccaacatccaggac
tggatcgcggaagcgcgtatcgacatcgagatgatccgcctgctcacgttcaaggccgcg
tatctgatggacacggtcgggaacaagggggcgcgcaccgagatcgcggccatcaaggtg
gccgccccgaacatcgcgttgaagatcatcgaccgcgcgatccaggtgcacggagcggcg
ggcgtgagcgaggacttcccgctggcgatgatgtacgcgcagctgcggacactgcggctc
gcggacggtcccgacgaggtccacaagcgagccatcgccaggcatgaactgggccggtac
cgcgacgccgccggggcggccggcggcacggtcacccccggcggtcacaaggcagtggtg
agctga

KEGG   Streptomyces avermitilis: SAVERM_5280
Entry
SAVERM_5280       CDS       T00126                                 

Gene name
fadE7
Definition
(GenBank) putative acyl-CoA dehydrogenase
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_5280 (fadE7)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_5280 (fadE7)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     SAVERM_5280 (fadE7)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N Acyl-CoA_ox_N THDPS_N_2
Other DBs
NCBI-ProteinID: BAC72992
NITE: SAV5280
UniProt: Q82CR3
Position
6397123..6398280
AA seq 385 aa
MRRTVFNEDHEAFRETLRAFIEAEVVPVYDEWFAAGQAPRDFYYKLAELGVFGIRVDEEH
GGAGIDSYKFEAVLYEETARAGISFGGSGVHVLLGLPYIKLLATDEQKKRFLPKFVSGEE
MWAIAMTEPGTGSDLAGMKTTAKLSDDGTHYVLNGAKTFITGGVHADRMIVCARTSAPTK
EDRRHGISLFVVDTKAEGYSVGRKLDKLGLKTSDTAELAFVDVKVPVEDLLGEENKGFYY
LGHNLASERWGIAFGAYAQAKAAVRFAKQYVQERVVFGQPVAAFQNTKFELAACQAEVDA
AEAVVDRATEALDAGELTPAEAASAKLFATEVAHRVIDRCLQLHGGYGFMNEYPIARLYA
DNRVNRIYGGTSEIMKTIIAKDMGL
NT seq 1158 nt   +upstreamnt  +downstreamnt
gtgcgccgtacggtgttcaacgaggatcacgaggcgttccgggagaccctgcgcgccttc
atcgaggccgaggtcgtcccggtctacgacgaatggttcgccgccggccaggcgccgcgc
gacttctactacaagctcgccgagctgggcgtcttcggcatccgcgtggacgaggagcac
ggcggcgcgggcatcgactcgtacaagttcgaggccgtcctgtacgaggagaccgcccgc
gcgggtatctccttcggcggctccggtgtgcacgtgctgctcggcctgccctacatcaag
ctgctcgccaccgacgagcagaagaagcgcttcctgccgaagttcgtctccggcgaggag
atgtgggccatcgcgatgaccgagccgggcaccggctccgacctcgcgggcatgaagacc
accgcgaagctctccgacgacggcacgcactacgtgctcaacggcgccaagaccttcatc
acgggtggcgtgcacgccgaccgcatgatcgtctgcgctcgcacctccgcgcccaccaag
gaggaccgccgccacggcatctccctcttcgtggtggacaccaaggccgagggctactcg
gtgggccgcaagctcgacaagctcggcctgaagacctcggacaccgccgagctggcgttc
gtcgacgtgaaggtcccggtcgaggacctcctcggcgaggagaacaagggcttctactac
ctcggccacaacctcgcctccgagcgttggggcatcgccttcggcgcgtacgcgcaggcc
aaggccgccgtccggttcgccaagcagtacgtgcaggagcgggtcgtcttcggccagccc
gtcgccgccttccagaacaccaagttcgaactggccgcctgccaggccgaggtggacgcg
gccgaggccgtcgtcgaccgggccaccgaggccctggacgccggtgagctgacccccgcc
gaggcggccagcgccaagctgttcgccaccgaggtcgcgcaccgtgtcatcgaccgctgc
ctccagctgcacggcggctacggcttcatgaacgagtacccgatagcccgcctctacgcg
gacaaccgcgtcaaccgcatctacggcggcaccagcgagatcatgaagacgatcatcgcc
aaggacatgggcctgtaa

KEGG   Streptomyces avermitilis: SAVERM_6614
Entry
SAVERM_6614       CDS       T00126                                 

Gene name
fadE17
Definition
(GenBank) putative acyl-CoA dehydrogenase
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_6614 (fadE17)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_6614 (fadE17)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     SAVERM_6614 (fadE17)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2
Other DBs
NCBI-ProteinID: BAC74325
NITE: SAV6614
UniProt: Q828P8
Position
complement(7914103..7915326)
AA seq 407 aa
MDFAFDARTEELRQKLLAFMDEHVYPAEAVAHEQRERLASPWDTPVIVEELKAEARRQGL
WNLFLPDSEYGAGLTNLQYAPLAEITGRSPQLAPTALNCAAPDTGNMEVLAQFGDERQRK
QWLEPLLAGEIRSAFAMTEPEVASSDATNITTLIERASDGTDEYVITGRKWYISGAMNPD
CKIFIVMGKTDPGGADIRRQQSMILVPRDTPGVQVKRAMQVYGYEDHSHGGHAEVIFDHA
RVPVSNLIGEEGGGFAIAQARLGPGRIHHCMRLIGMAERAIELMCRRAVSRTAFGKPLAQ
QGVVHNWIADARVAVEQLRLLVLKTAWMMDTVGNKGAHAEIQAIKIATPRTVVDIIDKAV
QLHGAGGVSQDFPLAELWASARTLKLADGPDEVHQRSLARRELKKYV
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggacttcgcgttcgacgcgcgcaccgaggaactgcgccagaagctcctcgccttcatg
gacgagcacgtctatccggcggaggccgtcgcccacgagcagcgcgagcggctcgcctcg
ccgtgggacacgcccgtgatcgtcgaggagctgaaggccgaggcccgccgccagggcctg
tggaacctcttcctgccggactccgagtacggcgccggactcaccaacctccagtacgcg
ccgctcgccgagatcaccggccgctccccgcagctggcgccgaccgcgctgaactgcgcg
gcgccggacaccggcaacatggaggtgcttgcgcagttcggcgacgagcgccagcgcaag
cagtggctggagccgctgctcgccggtgagatccgttcggcgttcgcgatgaccgagccc
gaggtggcctcctccgacgccaccaacatcaccacgctgatcgagcgcgcctccgacggc
acggacgagtacgtcatcaccggccgcaagtggtacatctccggggcgatgaacccggac
tgcaagatcttcatcgtgatgggcaagacggacccgggcggcgcggacatccggcgtcag
cagtccatgatcctggtcccccgcgacaccccgggtgtccaggtcaagcgggcgatgcag
gtgtacggctacgaggaccactcccacggcggccacgccgaggtgatcttcgaccacgcg
cgcgtgccggtgtcgaacctgatcggcgaggagggcggcggcttcgccatcgcccaggcc
cggctgggtccgggccgcatccaccactgcatgcggctgatcggcatggcggagcgggcg
atcgagctgatgtgcaggcgggccgtctcccgcacggccttcggcaagccgctggcccag
cagggcgtggtgcacaactggatcgccgacgcccgcgtggccgtcgaacagctgcggctg
ctggtgctgaagacggcctggatgatggacacggtcggcaacaagggggcccacgccgag
atccaggccatcaagatcgccacgccccgtacggttgtcgacatcatcgacaaggcggtc
cagctgcacggcgcgggcggcgtcagccaggacttcccgctggccgaactctgggcgagc
gcccgcacgctgaagctcgcggacggccccgacgaggtgcaccagcgctcgctggcgcgg
cgggagctgaagaagtacgtctga

DBGET integrated database retrieval system